PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zjn_sc00012.1.g07960.1.am.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 201aa MW: 21933.9 Da PI: 8.0163 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 28 | 4.9e-09 | 75 | 118 | 8 | 51 |
HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 rr+ NReA r++R++Kka + Lee+vk+L a N++L +l++ Zjn_sc00012.1.g07960.1.am.mk 75 RRALGNREAVRKYREKKKAHEAFLEEEVKKLRATNQQLLRRLQN 118 89999*********************************988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.9E-7 | 71 | 135 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.44E-7 | 73 | 119 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-13 | 74 | 136 | No hit | No description |
Pfam | PF07716 | 2.9E-13 | 74 | 125 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.6 | 75 | 117 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14686 | 5.53E-12 | 75 | 125 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MDSGGADLQS QLLFSYPEMP DSFDNFLNCS HRHGCDPPST SAAMHSHSCL HAHTQVIAVG 60 GVEDDEGGAE SSGPRRALGN REAVRKYREK KKAHEAFLEE EVKKLRATNQ QLLRRLQNHA 120 ALEAEAVRLR SLLLDVRGKI GAEVAGFPFP KQCGVDSGSA VGADPPALLI ELPYVTALKV 180 PAIINFLPLF KWRVAQRKSP S |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK354846 | 8e-49 | AK354846.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1012A02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001142351.1 | 1e-64 | uncharacterized protein LOC100274522 | ||||
Refseq | XP_020394445.1 | 1e-64 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394446.1 | 1e-64 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394447.1 | 1e-64 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394448.1 | 1e-64 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Refseq | XP_020394449.1 | 1e-64 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
Swissprot | Q8GTS2 | 8e-41 | BZP23_ARATH; Basic leucine zipper 23 | ||||
TrEMBL | A0A3L6EEA7 | 1e-64 | A0A3L6EEA7_MAIZE; Basic leucine zipper 23 | ||||
STRING | GRMZM2G175870_P01 | 4e-64 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3831 | 36 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35040.1 | 1e-39 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|