PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zjn_sc00009.1.g08920.1.am.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 213aa MW: 23524 Da PI: 10.3872 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.7 | 5.6e-18 | 125 | 172 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed +lvd+vk++G g+W+++ + g+ R++k+c++rw ++l Zjn_sc00009.1.g08920.1.am.mk 125 KGPWTSAEDSILVDYVKKHGEGNWNAVQKNTGLSRCGKSCRLRWANHL 172 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 24 | 8.8e-08 | 178 | 207 | 1 | 31 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 +g++T++E+ l+++++ ++G++ W++ a+++ Zjn_sc00009.1.g08920.1.am.mk 178 KGAFTPDEERLIIQLHSKMGNK-WARMAAHV 207 799*******************.*****997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.31 | 120 | 176 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-23 | 121 | 175 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.49E-25 | 122 | 207 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.8E-15 | 124 | 174 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.8E-16 | 125 | 172 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.67E-12 | 127 | 172 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.5E-14 | 176 | 207 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 9.918 | 177 | 213 | IPR017930 | Myb domain |
SMART | SM00717 | 0.94 | 177 | 213 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.1E-7 | 178 | 207 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.24E-4 | 180 | 207 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MTPFSLAKTN GKCSQAKLAV LRPYCARHHN RTLRTLISVA VASRLGEILL RFPLLSSPSF 60 QQSAAELTRA GEPLVELNSA HPGLDRLRRL RDSSESDCEM VPLDQMDSPA ADDGGSPHRG 120 PPLKKGPWTS AEDSILVDYV KKHGEGNWNA VQKNTGLSRC GKSCRLRWAN HLRPNLKKGA 180 FTPDEERLII QLHSKMGNKW ARMAAHVSAM LIS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-21 | 120 | 204 | 22 | 105 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF114938 | 1e-100 | EF114938.1 Triticum aestivum strain CRB-INRA-CFD-6086 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114939 | 1e-100 | EF114939.1 Triticum aestivum strain CRB-INRA-CFD-6529 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114940 | 1e-100 | EF114940.1 Triticum turgidum subsp. durum strain CRB-INRA-CFD-7657 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114941 | 1e-100 | EF114941.1 Triticum aestivum strain CRB-INRA-CFD-8048 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114942 | 1e-100 | EF114942.1 Triticum aestivum strain CRB-INRA-CFD-8058 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114943 | 1e-100 | EF114943.1 Triticum aestivum strain CRB-INRA-CFD-964 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114944 | 1e-100 | EF114944.1 Triticum aestivum strain CRB-INRA-CFD-9048 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114945 | 1e-100 | EF114945.1 Triticum aestivum strain CRB-INRA-CFD-13310 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114946 | 1e-100 | EF114946.1 Triticum aestivum strain CRB-INRA-CFD-13471 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114947 | 1e-100 | EF114947.1 Triticum aestivum strain CRB-INRA-CFD-13476 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114948 | 1e-100 | EF114948.1 Triticum aestivum strain CRB-INRA-CFD-13481 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114949 | 1e-100 | EF114949.1 Triticum aestivum strain CRB-INRA-CFD-13811 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114950 | 1e-100 | EF114950.1 Triticum aestivum strain CRB-INRA-CFD-15658 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114951 | 1e-100 | EF114951.1 Triticum aestivum strain CRB-INRA-CFD-1110 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114952 | 1e-100 | EF114952.1 Triticum aestivum strain CRB-INRA-CFD-1192 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114953 | 1e-100 | EF114953.1 Triticum aestivum strain CRB-INRA-CFD-1232 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114954 | 1e-100 | EF114954.1 Triticum aestivum strain CRB-INRA-CFD-1288 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114955 | 1e-100 | EF114955.1 Triticum aestivum strain CRB-INRA-CFD-2135 transcription factor (MybB) gene, partial cds. | |||
GenBank | EF114956 | 1e-100 | EF114956.1 Triticum aestivum strain CRB-INRA-CFD-2153 transcription factor (MybB) gene, partial cds. | |||
GenBank | HG670306 | 1e-100 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003564452.1 | 2e-68 | transcription factor GAMYB | ||||
Swissprot | A2WW87 | 2e-67 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | A0A0C6WCK4 | 2e-68 | A0A0C6WCK4_9POAL; ScMYB9 protein | ||||
TrEMBL | I1HSP4 | 5e-67 | I1HSP4_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G53010.1 | 9e-68 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3947 | 36 | 64 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06100.1 | 6e-53 | myb domain protein 33 |