PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g05570.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 224aa    MW: 25249.5 Da    PI: 8.997
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g05570.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.8e-081457344
                                  SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
               Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                                  +W++ Ed+ +  a ++++ +   +W+ Ia+ ++ gRt+ ++ +++
  Zjn_sc00009.1.g05570.1.am.mk 14 PWSKAEDKVFETALALWPDDtpeRWTMIAAQLP-GRTPQEVSEHY 57
                                  8*****************99*************.*******9998 PP

2Myb_DNA-binding27.28.8e-091672031147
                                   HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   l++++ +++G+g+W++I+r     Rt+ q+ s+ qky
  Zjn_sc00009.1.g05570.1.am.mk 167 LFLQGLEKYGPGDWRSISRFAVRSRTPTQVASHAQKY 203
                                   89**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.814765IPR017930Myb domain
SMARTSM007173.4E-81163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-71358IPR009057Homeodomain-like
SuperFamilySSF466894.81E-111367IPR009057Homeodomain-like
CDDcd001673.51E-71457No hitNo description
PfamPF002491.1E-61457IPR001005SANT/Myb domain
PROSITE profilePS512947.939148208IPR017930Myb domain
SMARTSM007170.33165206IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.0E-10166206IPR006447Myb domain, plants
CDDcd001672.89E-6166204No hitNo description
SuperFamilySSF466891.08E-9166206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-7167208IPR009057Homeodomain-like
PfamPF002491.1E-6167203IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MESHDDTPSP AGRPWSKAED KVFETALALW PDDTPERWTM IAAQLPGRTP QEVSEHYDAL  60
VADIELIESG AVEVPACWDA DDDGGSEESG ARGRRAGSGR GLPWSEEEHR YRASSSILRS  120
SIMQINRERT VAICLASRTS RPACLFVHKN LRRRVPRFLT PCVVCRLFLQ GLEKYGPGDW  180
RSISRFAVRS RTPTQVASHA QKYFKKHLNP RSSKRKSIYD ITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-191175771RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456680.18e-62transcription factor DIVARICATA
TrEMBLA0A3L6RGI03e-67A0A3L6RGI0_PANMI; Transcription factor DIVARICATA-like
STRINGSb03g040730.13e-61(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-31MYB family protein