PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g05440.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 526aa    MW: 57056.2 Da    PI: 9.5227
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g05440.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.1e-12260307148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++ Ed++l d + ++G g+W++ +++ g+ R +k+c++rw +yl
  Zjn_sc00004.1.g05440.1.am.mk 260 KGLWSPGEDQKLRDFIVRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 307
                                   678*******************************************97 PP

2Myb_DNA-binding52.89.3e-17314358248
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   g ++ eE+e   +++++lG++ W+ Iar+++ gRt++++k++w++yl
  Zjn_sc00004.1.g05440.1.am.mk 314 GMFSREEEETVMNLHAKLGNK-WSHIARHLP-GRTDNEVKNYWNSYL 358
                                   56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.296255307IPR017930Myb domain
SuperFamilySSF466896.74E-27258354IPR009057Homeodomain-like
SMARTSM007173.2E-9259309IPR001005SANT/Myb domain
PfamPF002495.7E-11260307IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-19261314IPR009057Homeodomain-like
CDDcd001672.73E-8263307No hitNo description
PROSITE profilePS5129425.468308362IPR017930Myb domain
SMARTSM007173.5E-14312360IPR001005SANT/Myb domain
PfamPF002494.5E-15314358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-25315361IPR009057Homeodomain-like
CDDcd001676.37E-12316358No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MRVETKHPKQ VRAGSHRDVK PGGSRLPDHD PKFIGPDAMH SRRMCKLSSD SCAQNARKLT  60
MRARAARGRG AWPHGGDDDP GRPEAEADAA DPPLPLTPFW RFGAGQRLGS GPGSPCSCRS  120
PARETEPNQR GGDGARQRRN AVFAAHREKK RLRVFRFQQG FDSGAASIGG GHLVRRLPSP  180
HQISIQPDKL RLSYKALRAT SSRCPHANAD RHHSASAPPV SSLLLLDSTQ PELPSSSCRA  240
LRSRSMGCKA CQKPKVQCRK GLWSPGEDQK LRDFIVRYGH GCWSALPAKA GLQRNGKSCR  300
LRWINYLRPG LKHGMFSREE EETVMNLHAK LGNKWSHIAR HLPGRTDNEV KNYWNSYLKK  360
RVEGGQASKC AADSDVSGST NTSETSQERL NRPASSESSS PVESSSADDS SCLTVTEPVA  420
PAAAAALRPH APVLPRVMFA DWLDMDYGTN LMAPGLDHAG VFDVMNGRSP TQGAVQVDGP  480
CGAVDSLHGL DDGGVCWGFD AAADQMDVQG AGFCDLLSMS EFLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-252603637109B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915921e-136FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976342.11e-162transcription factor LAF1
TrEMBLA0A1E5W1231e-161A0A1E5W123_9POAL; Transcription factor LAF1
TrEMBLK3YDJ91e-161K3YDJ9_SETIT; Uncharacterized protein
STRINGSi012304m1e-162(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.12e-53myb domain protein 19