PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g15450.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 324aa    MW: 36548.5 Da    PI: 7.3214
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g15450.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.11.5e-48131393128
                             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                     pGfrFhPt+eel+++yL+  v+gkkl++ ++i +++iy++ePwdLp ++k++e+ewyfF++rd+++ +g r+nr+t++g
  Zjn_sc00002.1.g15450.1.sm.mkhc  13 PGFRFHPTEEELLDFYLHCVVHGKKLNF-DIIGTLNIYRHEPWDLPGMAKTGEREWYFFVPRDRRAGSGGRPNRTTEHG 90 
                                     9*************************99.99***************999999*************************** PP

                             NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +Wkatg+d+++ s+   ++++glkktLvfykgrap+g+ktdWvm+eyrl
  Zjn_sc00002.1.g15450.1.sm.mkhc  91 FWKATGSDRAIRSSadAKRVIGLKKTLVFYKGRAPRGTKTDWVMNEYRL 139
                                     ************99777888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-563166IPR003441NAC domain
PROSITE profilePS5100553.71511166IPR003441NAC domain
PfamPF023651.9E-2413139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAMASMEMEQ DLPGFRFHPT EEELLDFYLH CVVHGKKLNF DIIGTLNIYR HEPWDLPGMA  60
KTGEREWYFF VPRDRRAGSG GRPNRTTEHG FWKATGSDRA IRSSADAKRV IGLKKTLVFY  120
KGRAPRGTKT DWVMNEYRLP EFGFATGRAA PAPPKEDMVL CKIYRKATPL KELEQRASDM  180
EERQRRSNLD YVPRAPLVRV TPSAGDDYLS PDDGHDSFLI PSSSSSPPSE YSYSYNAPIM  240
EAKKEADATV TLAAMSLPPL QPITATPAAV NVPSTQHPTA RHGDLPSLQV PANHVVFDWL  300
QDPFLLRSPW QDQLFLSPLA NLLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-451316819167NO APICAL MERISTEM PROTEIN
1ut4_B2e-451316819167NO APICAL MERISTEM PROTEIN
1ut7_A2e-451316819167NO APICAL MERISTEM PROTEIN
1ut7_B2e-451316819167NO APICAL MERISTEM PROTEIN
3swm_A2e-451316822170NAC domain-containing protein 19
3swm_B2e-451316822170NAC domain-containing protein 19
3swm_C2e-451316822170NAC domain-containing protein 19
3swm_D2e-451316822170NAC domain-containing protein 19
3swp_A2e-451316822170NAC domain-containing protein 19
3swp_B2e-451316822170NAC domain-containing protein 19
3swp_C2e-451316822170NAC domain-containing protein 19
3swp_D2e-451316822170NAC domain-containing protein 19
4dul_A2e-451316819167NAC domain-containing protein 19
4dul_B2e-451316819167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070901e-156AK107090.1 Oryza sativa Japonica Group cDNA clone:002-121-G12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795753.11e-166NAC domain-containing protein 22
SwissprotQ10S651e-135NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3L6S6V01e-167A0A3L6S6V0_PANMI; NAC domain-containing protein 67-like
STRINGPavir.J24394.1.p1e-159(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.16e-84NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]