PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01038090001
Common NameVIT_05s0094g00020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Nin-like
Protein Properties Length: 862aa    MW: 95168.4 Da    PI: 6.3605
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01038090001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.37.3e-29528579152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek++sl+ l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  GSVIVT01038090001 528 AEKNVSLSLLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 579
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154512599IPR003035RWP-RK domain
PfamPF020425.5E-26531579IPR003035RWP-RK domain
SuperFamilySSF542771.9E-22729819No hitNo description
SMARTSM006662.1E-22735817IPR000270PB1 domain
PROSITE profilePS5174521.336735817IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-24735817No hitNo description
PfamPF005642.2E-16736816IPR000270PB1 domain
CDDcd064073.00E-33736816No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MSPLQSMPYS DVFNFSDQNV ATNSVSDGRG TFNVAGSSFS SGDKMPFQPM DSQFGFSLNS  60
TEADNSNATR SNNSPFQQNF VSEIGSDARR SIRRPLAEKM LTALSFFKQS CEGGILAQVW  120
VPIRTGDHYM LSTYEQPYLL DQTLAGYREV SRAFTFSAED KSGLLPGLPG RVFMSKVPEW  180
TSNVGYYNLE EYLRVKHAAH HDVRGSIALP VFDPPEMSCC AVLELVTVEE KSNFDSEMEM  240
VCQALEAVNL KSTTPPRLQQ QYSNNQRAAL AEITDVLRAV CHAHRLPLAL TWIPCNFIRG  300
DADEIIRVRI KQSNTSSSGK CMLCIEETAC YVNDREMQGF VHACMKHYIE EGQGVSGKAL  360
QSNHPFFFQD VKKYDISEYP LVHHARKFGL NAAVAIRLRS TFTGNDDYIL EFFLPLSMKG  420
SPEQQLLLNN LSGTMQKMCR SLRRVSDTEL LGVECSKFGI ERGALTNLPP MPVSGSNSQL  480
ESSEFEFNLD RMALDASNLG VEGMVASVPR EKKTSGSRRQ QDKRRTVAEK NVSLSLLQQY  540
FSGSLKDAAK SIGVCPTTLK RICRQHGISR WPSRKINKVN RSLRKIQTVL SSVQGVEGGL  600
KFDPATGGLV AAGSVIQDFV VDGEQNLNPP RREQKTSNIA LVDCSEDSRS MDLESGSFRT  660
WGARSSTTTF PAAAAVAAAN EMDTVVDGDQ PTSSGMTASS NSSASMVHAS SSSSPSFERQ  720
LPARGKTKVE DGGSKITVKA TYKEDTIRFK FEPSAGCFQL YDEVARRFGL QIGTFQLKYL  780
DDEEEWVMLV NDADLQECLD ILEDVGSRSV KFLVRDTPAA MGSSGSSNCF LIVFSQIMNE  840
NTSFFMQQSL HFLPALIHFT S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.52200.0bud| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4408810.0AM440881.2 Vitis vinifera contig VV78X076853.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010650663.10.0PREDICTED: protein NLP9 isoform X1
RefseqXP_010650664.10.0PREDICTED: protein NLP9 isoform X1
RefseqXP_010650665.10.0PREDICTED: protein NLP9 isoform X1
RefseqXP_010650666.10.0PREDICTED: protein NLP9 isoform X1
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLF6HB000.0F6HB00_VITVI; Uncharacterized protein
STRINGVIT_05s0094g00020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]