PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01037026001 | ||||||||
Common Name | LOC100242931, VIT_03s0088g00590, VITISV_024203 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 195aa MW: 22012.5 Da PI: 9.7759 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69.7 | 2.7e-22 | 17 | 63 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 i k qvtfskRr g++KKA+EL++LC+a+va+i+fs+ gk++ + GSVIVT01037026001 17 IPKKNHLQVTFSKRRSGLFKKASELCTLCGANVAIIVFSPAGKVFSF 63 55677789************************************988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.5E-32 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 24.53 | 7 | 67 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.36E-28 | 8 | 87 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.40E-34 | 8 | 75 | No hit | No description |
PRINTS | PR00404 | 5.0E-19 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.4E-24 | 16 | 63 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-19 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-19 | 44 | 65 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MVKKPSKGRQ KIEISKIPKK NHLQVTFSKR RSGLFKKASE LCTLCGANVA IIVFSPAGKV 60 FSFGHPDVES IVDRFFTVRE LNLQLTQVLN QLEAEKKRGE ILSQMRRASQ TQCWWEAPIN 120 ELSMPELEQL KVSMEELKKV VLSQGDKLLM EAANPSPFYM INGSSAMVDH FEIERKPSEI 180 HGNVHNFGYG QGFF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-15 | 8 | 99 | 2 | 92 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM441828 | 0.0 | AM441828.2 Vitis vinifera contig VV78X276199.7, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002270964.1 | 1e-137 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 2e-51 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A438JMK9 | 1e-136 | A0A438JMK9_VITVI; Agamous-like MADS-box protein AGL62 | ||||
STRING | VIT_03s0088g00590.t01 | 1e-137 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 7e-46 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01037026001 |
Entrez Gene | 100242931 |