PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01037022001

Common Name

LOC100263465, VIT_03s0088g00610

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

M-type_MADS

Protein Properties

Length: 220aa MW: 24661.5 Da PI: 8.8292

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01037022001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	65.2	6.9e-21	18	63	4	49
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k qvtfskR+ g++KKA+EL++LC+a++a+++fs+ gk++ + GSVIVT01037022001 18 PKKNHLQVTFSKRKSGLFKKASELCTLCGANIAILVFSPGGKVFSF 63 5667789************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	23.745	7	67	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.1E-31	7	66	IPR002100	Transcription factor, MADS-box
CDD	cd00120	4.84E-30	8	66	No hit	No description
SuperFamily	SSF55455	1.83E-24	8	80	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.2E-18	9	29	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.4E-23	16	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.2E-18	29	44	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.2E-18	44	65	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 220 aa Download sequence Send to blast
MVEKSSKGRQ KIEIAKIPKK NHLQVTFSKR KSGLFKKASE LCTLCGANIA ILVFSPGGKV 60 FSFGHPDVRY IVYSFFANIP PTKRSDLNLI EAHDQNASIH KLNLQLAEVL NQLEAEKKRG 120 EILGQIRASQ GQCWWEAPID ELSLFELQQL KVSMEELKKI VVSQAELLLM EGNANPSTFN 180 KVNGYPMVDD FEFERKLSEI HGLSIVPHVH NFGHGLGFF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3kov_B	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3kov_I	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3kov_J	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3p57_A	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3p57_B	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3p57_C	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3p57_D	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3p57_I	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
3p57_J	7e-15	8	92	1	86	Myocyte-specific enhancer factor 2A
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269\|PubMed:18334668}.
Uniprot	TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:18334668}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM440172	0.0	AM440172.2 Vitis vinifera contig VV78X025022.2, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002270816.1	1e-161	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	9e-50	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A438JMK5	1e-160	A0A438JMK5_VITVI; Agamous-like MADS-box protein AGL62
TrEMBL	D7T3M9	1e-160	D7T3M9_VITVI; Uncharacterized protein
STRING	VIT_03s0088g00610.t01	1e-161	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	4e-52	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	GSVIVT01037022001
Entrez Gene	100263465

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]