PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01035467001

Common Name

LOC100250947, VIT_04s0008g01870

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

MYB

Protein Properties

Length: 198aa MW: 22587.7 Da PI: 9.6911

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01035467001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.1	1.8e-17	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l+++++ +G ++Wk +a + g++R++k+c++rw +yl GSVIVT01035467001 15 RGAWTAEEDHKLAQVIAVHGAKRWKCVAMKAGLKRCGKSCRLRWMNYL 62 89********************************************97 PP
2	Myb_DNA-binding	49.3	1.1e-15	68	113	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l GSVIVT01035467001 68 RGNISDQEQDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.703	10	62	IPR017930	Myb domain
SuperFamily	SSF46689	5.87E-28	14	109	IPR009057	Homeodomain-like
SMART	SM00717	3.7E-12	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	4.1E-16	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.0E-23	16	69	IPR009057	Homeodomain-like
CDD	cd00167	1.03E-8	17	62	No hit	No description
PROSITE profile	PS51294	24.588	63	117	IPR017930	Myb domain
SMART	SM00717	5.4E-15	67	115	IPR001005	SANT/Myb domain
Pfam	PF00249	4.5E-14	68	113	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-24	70	116	IPR009057	Homeodomain-like
CDD	cd00167	1.27E-9	72	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 198 aa Download sequence Send to blast
MASTISQCTK KEANRGAWTA EEDHKLAQVI AVHGAKRWKC VAMKAGLKRC GKSCRLRWMN 60 YLRPNIKRGN ISDQEQDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKTKQK 120 EKQSRSSTTV ECRPQKTKVM EMESVDNGSE RVASKGDEDS KTSFVGDESF DYSSEGPLNL 180 EWMSKFLEMD EAWLDFA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-27	15	117	7	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:16207757}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM447374	0.0	AM447374.2 Vitis vinifera contig VV78X218392.6, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002279941.1	1e-146	PREDICTED: transcription factor MYB114
Swissprot	Q9SEI0	4e-53	WER_ARATH; Transcription factor WER
TrEMBL	A0A438EWZ4	1e-145	A0A438EWZ4_VITVI; Transcription factor WER
TrEMBL	D7STX1	1e-145	D7STX1_VITVI; Uncharacterized protein
STRING	VIT_04s0008g01870.t01	1e-146	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-55	myb domain protein 66

Link Out ? help Back to Top
Phytozome	GSVIVT01035467001
Entrez Gene	100250947

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]