PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01035464001 | ||||||||
Common Name | VIT_04s0008g01840, VITISV_010997 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 227aa MW: 26008.8 Da PI: 6.0531 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.2 | 6.8e-17 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed+ll d+vk +G+g W+ ++++ g+ R++k+c++rw++yl GSVIVT01035464001 13 RGAWTALEDKLLRDYVKTHGPGKWRNVSQETGLERSGKSCRLRWLNYL 60 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 9.5e-17 | 66 | 110 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ ++eE++l+++++k+lG++ W++Ia +++ gR+++++k++w++ GSVIVT01035464001 66 RGNISPEEEDLIIRLHKLLGNR-WSLIAGRLP-GRSDNEIKNYWNTT 110 7999******************.*********.************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.883 | 8 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.13E-29 | 10 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.9E-14 | 12 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.2E-23 | 14 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.23E-10 | 15 | 60 | No hit | No description |
Pfam | PF13921 | 8.0E-16 | 16 | 74 | No hit | No description |
PROSITE profile | PS51294 | 25.143 | 61 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-16 | 65 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-25 | 68 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.53E-11 | 70 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MEKSHPCTRR SNRGAWTALE DKLLRDYVKT HGPGKWRNVS QETGLERSGK SCRLRWLNYL 60 RPDIKRGNIS PEEEDLIIRL HKLLGNRWSL IAGRLPGRSD NEIKNYWNTT LAKRVVHGQN 120 SNQSKDDRKE KEKEPSNMDE APMEMKGSEG PDPVNDFKED YSPNPAMDFS GKLFQYNDTD 180 YDQLWNFSDF DDGRWGCGNM GGANGLCQWS DFPSASAEEA EIFFHS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-26 | 12 | 115 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM424675 | 0.0 | AM424675.2 Vitis vinifera contig VV78X269243.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002279918.2 | 1e-169 | PREDICTED: transcription factor WER | ||||
Swissprot | Q9SEI0 | 1e-50 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A438K8A3 | 1e-168 | A0A438K8A3_VITVI; Transcription factor WER | ||||
STRING | VIT_04s0008g01840.t01 | 1e-169 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 4e-53 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01035464001 |