PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01034621001

Common Name

VIT_13s0073g00400

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

bHLH

Protein Properties

Length: 179aa MW: 20332.6 Da PI: 10.1291

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01034621001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	42.6	1.1e-13	3	55	1	55
CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 ++ +hn r RR++iNs ++ Lr+llP+a + kKls +++ + +YI +Lq GSVIVT01034621001 3 KKLNHNVSVRDRRKKINSLYSSLRSLLPSA--DQVKKLSIPSTVSCVLKYIPELQ 55 6789***********************6..49999*************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	13.649	2	54	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	7.2E-12	3	69	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	1.7E-10	3	55	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	1.23E-13	3	71	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SMART	SM00353	8.8E-8	8	60	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0010106	Biological Process	cellular response to iron ion starvation
GO:0055072	Biological Process	iron ion homeostasis
GO:0016021	Cellular Component	integral component of membrane
GO:0090575	Cellular Component	RNA polymerase II transcription factor complex
GO:0000977	Molecular Function	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009005	anatomy	root
PO:0007520	developmental stage	root development stage

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
MVKKLNHNVS VRDRRKKINS LYSSLRSLLP SADQVKKLSI PSTVSCVLKY IPELQRQVER 60 LIQKKEEFLS KISREGDLIH LENQRNGTLG SSLSAVSARR LSDREIVVQI STFKVHESPL 120 SEVLLNLEED GLLVINASSF ESFGGRVFYN LHLQVLFLSI FFLISFSFSP LNFYSFII*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Roots. {ECO:0000269\|PubMed:12679534}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by OBP3, auxin and salicylic acid (SA). Repressed by jasmonic acid (JA), UV LIGHT, and heat treatments. Up regulated by iron deficiency in roots and leaves, as well as by nickel, high zinc or high copper treatments. Repressed by high iron, low copper and low zinc treatments. {ECO:0000269\|PubMed:12679534, ECO:0000269\|PubMed:12887587, ECO:0000269\|PubMed:17516080}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM480192	0.0	AM480192.2 Vitis vinifera contig VV78X014995.11, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002267985.1	1e-105	PREDICTED: transcription factor ORG2 isoform X1
Swissprot	Q9M1K1	4e-54	ORG2_ARATH; Transcription factor ORG2
TrEMBL	F6HBH6	1e-121	F6HBH6_VITVI; Uncharacterized protein
STRING	VIT_13s0073g00400.t01	1e-121	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP2826	11	29

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56970.1	1e-41	bHLH family protein

Link Out ? help Back to Top
Phytozome	GSVIVT01034621001

Publications ? help Back to Top
Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature. Differentiation, 2010. 80(1): p. 1-8 [PMID:20219281] Matsuoka K, et al. Gibberellin-induced expression of Fe uptake-related genes in Arabidopsis. Plant Cell Physiol., 2014. 55(1): p. 87-98 [PMID:24192296] Li X,Zhang H,Ai Q,Liang G,Yu D Two bHLH Transcription Factors, bHLH34 and bHLH104, Regulate Iron Homeostasis in Arabidopsis thaliana. Plant Physiol., 2016. 170(4): p. 2478-93 [PMID:26921305] Shen C, et al. Involvement of endogenous salicylic acid in iron-deficiency responses in Arabidopsis. J. Exp. Bot., 2016. 67(14): p. 4179-93 [PMID:27208542] Liang G,Zhang H,Li X,Ai Q,Yu D bHLH transcription factor bHLH115 regulates iron homeostasis in Arabidopsis thaliana. J. Exp. Bot., 2017. 68(7): p. 1743-1755 [PMID:28369511] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Kailasam S,Wang Y,Lo JC,Chang HF,Yeh KC S-Nitrosoglutathione works downstream of nitric oxide to mediate iron-deficiency signaling in Arabidopsis. Plant J., 2018. 94(1): p. 157-168 [PMID:29396986] Kurt F,Filiz E Genome-wide and comparative analysis of bHLH38, bHLH39, bHLH100 and bHLH101 genes in Arabidopsis, tomato, rice, soybean and maize: insights into iron (Fe) homeostasis. Biometals, 2018. 31(4): p. 489-504 [PMID:29546482]