PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01033670001 | ||||||||
Common Name | VIT_08s0007g04830 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 124aa MW: 14667.7 Da PI: 10.4579 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.7 | 4.9e-17 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEde+l v +lG ++W++Iar g++R++k+c++rw++yl GSVIVT01033670001 8 KGSWLEEEDERLTAFVGLLGERRWDSIARASGLKRSGKSCRLRWLNYL 55 799********************************************7 PP | |||||||
2 | Myb_DNA-binding | 49.5 | 9.5e-16 | 65 | 106 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 ++eE++++++++k++G++ W+ Iar ++ gRt++++k++w+++l GSVIVT01033670001 65 SAEEEQIILQLHKRWGNK-WSWIARSLP-GRTDNEIKNYWRTHL 106 89****************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.949 | 3 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.49E-27 | 5 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-13 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-20 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.68E-8 | 10 | 55 | No hit | No description |
SMART | SM00717 | 2.1E-12 | 60 | 108 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.093 | 60 | 110 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-22 | 63 | 109 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-13 | 65 | 106 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.14E-9 | 65 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MQGENLRKGS WLEEEDERLT AFVGLLGERR WDSIARASGL KRSGKSCRLR WLNYLRPDLK 60 RCQISAEEEQ IILQLHKRWG NKWSWIARSL PGRTDNEIKN YWRTHLRKRT EIEEQGILQF 120 SAS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-28 | 6 | 110 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM456538 | 9e-69 | AM456538.2 Vitis vinifera contig VV78X145138.21, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002265893.2 | 7e-79 | PREDICTED: myb-related protein 305 | ||||
Swissprot | Q9SCP1 | 6e-53 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | D7TIT3 | 7e-83 | D7TIT3_VITVI; Uncharacterized protein | ||||
STRING | VIT_08s0007g04830.t01 | 1e-83 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 2e-55 | myb domain protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01033670001 |
Publications ? help Back to Top | |||
---|---|---|---|
|