PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01033194001 | ||||||||
Common Name | VIT_04s0069g00970 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 157aa MW: 17467.3 Da PI: 6.3464 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.3 | 4.3e-30 | 67 | 125 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDg++WrKYG+K+vk+s++pr+YYrC+s +C+vkk++er+ ed ++v++tY+g Hnh+ GSVIVT01033194001 67 MDDGFKWRKYGKKMVKSSPNPRNYYRCSSGDCQVKKRIERDIEDSSYVITTYTGIHNHP 125 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.8E-31 | 56 | 127 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.76E-28 | 59 | 127 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.861 | 62 | 127 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.1E-32 | 67 | 126 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.0E-22 | 68 | 125 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MLEDGSEEDS CSQTTAAASA VTVTGTGHID QLIHTATPTH DGVRRSKESD DGARVVAFRT 60 KSELDVMDDG FKWRKYGKKM VKSSPNPRNY YRCSSGDCQV KKRIERDIED SSYVITTYTG 120 IHNHPIPGVG YYNQMPLMVP YDYDWTLQAS SQSPFS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-23 | 57 | 127 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 3e-23 | 57 | 127 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM462490 | 1e-107 | AM462490.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X161195.8, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002263836.1 | 1e-114 | PREDICTED: probable WRKY transcription factor 51 isoform X1 | ||||
Swissprot | Q93WU9 | 7e-39 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | D7T0E7 | 1e-114 | D7T0E7_VITVI; Uncharacterized protein | ||||
STRING | VIT_04s0069g00970.t01 | 1e-114 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 2e-39 | WRKY DNA-binding protein 51 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01033194001 |
Publications ? help Back to Top | |||
---|---|---|---|
|