PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01032752001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 127aa MW: 14068.2 Da PI: 8.596 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144 | 4.6e-45 | 6 | 105 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +Ca+Ck+lrr+CakdC++apyfp+++p+kf +vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq q++ql+ GSVIVT01032752001 6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFSIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQTQVSQLQM 97 7******************************************************************************************* PP DUF260 93 elallkee 100 +la++++e GSVIVT01032752001 98 QLAVAQAE 105 ****9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.955 | 5 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.2E-44 | 6 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFSIVHK VFGASNVSKM LQELPVHQRA 60 DAVSSLVYEA NARVRDPVYG CVGAISYLQT QVSQLQMQLA VAQAEIFCIQ MQQEQQVKNK 120 VYQQSV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-49 | 2 | 107 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-49 | 2 | 107 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM436573 | 1e-101 | AM436573.2 Vitis vinifera contig VV79X000523.2, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010658225.1 | 3e-81 | PREDICTED: LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 1e-73 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | F6HCA7 | 7e-80 | F6HCA7_VITVI; Uncharacterized protein | ||||
STRING | VIT_13s0067g01880.t01 | 1e-80 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 5e-76 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01032752001 |
Publications ? help Back to Top | |||
---|---|---|---|
|