PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01032415001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 202aa MW: 22072 Da PI: 8.3647 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 137.3 | 5.4e-43 | 41 | 139 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++ GSVIVT01032415001 41 PCAACKLLRRKCMPGCIFAPYFPPEEPQKFINVHKIFGASNVSKLLNEILPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVLRLQK 132 7******************************************************************************************* PP DUF260 93 elallke 99 el+++++ GSVIVT01032415001 133 ELDATNA 139 **99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.295 | 40 | 141 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.4E-42 | 41 | 138 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MELIVLPTLD YFYSSTNLER DHTRGKRKVL KMASSSYSNS PCAACKLLRR KCMPGCIFAP 60 YFPPEEPQKF INVHKIFGAS NVSKLLNEIL PHQREDAVNS LAYEAEARMK DPVYGCVGAI 120 SVLQRQVLRL QKELDATNAD LIRFTCNDMS SSLSGPGSSQ FGRRMSHGGG GGGASFNQNS 180 GLPPPYPSPW DNNPSGDSHE S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-65 | 38 | 149 | 8 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-65 | 38 | 149 | 8 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM455006 | 0.0 | AM455006.1 Vitis vinifera contig VV78X258680.8, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002273053.1 | 1e-125 | PREDICTED: LOB domain-containing protein 25 | ||||
Refseq | XP_010660868.1 | 1e-125 | PREDICTED: LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 1e-66 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A438JI69 | 1e-125 | A0A438JI69_VITVI; Protein lateral organ boundaries | ||||
STRING | VIT_14s0066g00680.t01 | 1e-124 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-69 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01032415001 |
Publications ? help Back to Top | |||
---|---|---|---|
|