PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01030963001 | ||||||||
Common Name | VIT_14s0006g02320 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 130aa MW: 14306.4 Da PI: 6.871 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 64.9 | 1.5e-20 | 1 | 62 | 38 | 99 |
NF-YC 38 misaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 misa++ +l++ka elfileltlr+w hae nkrrtl+ +di a+ + fl++i p GSVIVT01030963001 1 MISADSQILFAKASELFILELTLRAWFHAEANKRRTLQPCDIGRAIRCYPTLHFLTNIAPDV 62 8*******************************************************999865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.1E-15 | 1 | 60 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.36E-14 | 1 | 61 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.6E-7 | 2 | 45 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MISADSQILF AKASELFILE LTLRAWFHAE ANKRRTLQPC DIGRAIRCYP TLHFLTNIAP 60 DVHKEEHSEN ISGGAGFVVA NEGVHFPAAN HELIMWNHEI PCSVQLPPIT SSEMVNKNAP 120 KRGKCDGGM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_B | 8e-18 | 1 | 60 | 37 | 96 | NF-YC |
4awl_C | 7e-18 | 1 | 60 | 34 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA |
4csr_B | 7e-18 | 1 | 60 | 34 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.4468 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM478819 | 1e-103 | AM478819.2 Vitis vinifera contig VV78X211569.3, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003633710.2 | 1e-93 | PREDICTED: nuclear transcription factor Y subunit C-4 | ||||
Swissprot | Q9FMV5 | 2e-20 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
TrEMBL | D7TSY6 | 2e-92 | D7TSY6_VITVI; Uncharacterized protein | ||||
STRING | VIT_14s0006g02320.t01 | 4e-93 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP315 | 17 | 117 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63470.2 | 1e-22 | nuclear factor Y, subunit C4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01030963001 |