PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01028328001 | ||||||||
Common Name | VIT_07s0005g03340 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 234aa MW: 26684.1 Da PI: 6.8509 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.2 | 9.2e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv++++++G g+W++ ++ g+ R++k+c++rw +yl GSVIVT01028328001 14 KGPWTPEEDQILVNYIHLYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.6 | 1.2e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l GSVIVT01028328001 67 RGNFTSEEEETIIELHERLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.5E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.077 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.3E-32 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.14E-12 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.498 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-27 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.3E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRAPCCEKM GLKKGPWTPE EDQILVNYIH LYGHGNWRAL PKQAGLLRCG KSCRLRWTNY 60 LRPDIKRGNF TSEEEETIIE LHERLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLKHNH 120 ATPPPKRHSL DASHVEKQQN PISSATNSRS ESLGYGPVLS PQQSFSDISS AATTTTTATM 180 SDITTPCIKV DSLEEFPEMD ENFWSEVLTY DMDMEFWYNI FTRSGELHEL SEI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-28 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.17367 | 0.0 | cell culture| leaf| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Fades out in old roots and leaves. {ECO:0000269|PubMed:24415840}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in imbibed seeds, hypocotyls, cotyledons, roots, seedlings, siliques and flowers. {ECO:0000269|PubMed:24415840}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU181424 | 0.0 | EU181424.1 Vitis vinifera R2R3 Myb14 transcription factor (MYB14) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001268132.1 | 1e-146 | R2R3 Myb14 transcription factor | ||||
Swissprot | Q9SJX8 | 5e-86 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | F6HZJ9 | 1e-168 | F6HZJ9_VITVI; Uncharacterized protein | ||||
STRING | VIT_07s0005g03340.t01 | 1e-169 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-76 | myb domain protein 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01028328001 |
Publications ? help Back to Top | |||
---|---|---|---|
|