PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01027810001 | ||||||||
Common Name | VIT_05s0049g01010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 145aa MW: 16408.9 Da PI: 10.7647 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61 | 2.6e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv v+++G g+W++ ++ g+ R++k+c++rw +yl GSVIVT01027810001 14 KGPWTPEEDKILVAHVQKHGHGNWRALPKQAGLLRCGKSCRLRWVNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.9 | 8.5e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+++ eE++ ++d++++lG++ W++Ia++++ gRt++++k+ w++ GSVIVT01027810001 67 RGNFSREEEDAIIDLHEKLGNR-WSAIAARLP-GRTDNEIKNVWHTN 111 89********************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-27 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.08 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.16E-32 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.6E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.20E-12 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.752 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-26 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.69E-10 | 69 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MARSPCCDKM GLKKGPWTPE EDKILVAHVQ KHGHGNWRAL PKQAGLLRCG KSCRLRWVNY 60 LRPDIKRGNF SREEEDAIID LHEKLGNRWS AIAARLPGRT DNEIKNVWHT NLKKRLKKKL 120 ATPNSKGHST AAASKCDSGT WRYT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-28 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC514110 | 1e-126 | KC514110.1 Vitis vinifera cultivar Shiraz R2R3 MYB15 transcription factor (myb15) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002281274.1 | 2e-99 | PREDICTED: myb-related protein Myb4 | ||||
Swissprot | Q7XBH4 | 5e-78 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | D7SZG7 | 1e-102 | D7SZG7_VITVI; Uncharacterized protein | ||||
STRING | VIT_05s0049g01010.t01 | 1e-103 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 2e-74 | myb domain protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01027810001 |
Publications ? help Back to Top | |||
---|---|---|---|
|