PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01027407001 | ||||||||
Common Name | VIT_15s0048g02870 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 194aa MW: 22201.5 Da PI: 4.4795 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 42.6 | 1e-13 | 1 | 39 | 18 | 56 |
HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +Fe++ ++ +++ + Ak+lgL+ rqV +WFqN+Ra++k GSVIVT01027407001 1 MFESETKLEPRKKLQVAKELGLQPRQVAIWFQNKRARWK 39 6999**********************************9 PP | |||||||
2 | HD-ZIP_I/II | 101.3 | 8.5e-33 | 1 | 77 | 17 | 93 |
HD-ZIP_I/II 17 sFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 +Fe+e+kLep++K ++a+eLglqprqva+WFqn+RAR+k+kqlE+dy+ L+ +y++l+++ e+L+ke+++L +l++ GSVIVT01027407001 1 MFESETKLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYSILRGNYNSLVSRFESLKKEKQALVIQLQK 77 6999*******************************************************************999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00046 | 3.8E-11 | 1 | 39 | IPR001356 | Homeobox domain |
SMART | SM00389 | 0.0027 | 1 | 45 | IPR001356 | Homeobox domain |
PROSITE profile | PS50071 | 14.009 | 1 | 41 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.47E-12 | 2 | 53 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-13 | 2 | 48 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.67E-9 | 2 | 42 | No hit | No description |
PRINTS | PR00031 | 2.5E-5 | 12 | 21 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 16 | 39 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 2.5E-5 | 21 | 37 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 1.0E-16 | 41 | 83 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MFESETKLEP RKKLQVAKEL GLQPRQVAIW FQNKRARWKS KQLERDYSIL RGNYNSLVSR 60 FESLKKEKQA LVIQLQKLNE MVQQSGGAKQ DSEQRLVQNS AESEADNRDN GNCESEVKPN 120 LSLERSEHGG GVLSDDDSSI RADYFVMEEE PSLLTMVEPV DGCLTSPEDW GSWDSENVFD 180 QSSGSYQWWD FWG* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.2402 | 0.0 | bud| fruit| leaf| pedicel |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00320 | DAP | Transfer from AT2G46680 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM459126 | 0.0 | AM459126.1 Vitis vinifera contig VV78X035546.6, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002262950.3 | 1e-140 | PREDICTED: homeobox-leucine zipper protein ATHB-12 | ||||
Swissprot | P46897 | 2e-58 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A438IFA0 | 1e-138 | A0A438IFA0_VITVI; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | F6I2W3 | 1e-138 | F6I2W3_VITVI; Uncharacterized protein | ||||
STRING | VIT_15s0048g02870.t01 | 1e-139 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP129 | 16 | 189 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46680.1 | 7e-61 | homeobox 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01027407001 |
Publications ? help Back to Top | |||
---|---|---|---|
|