PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01027172001 | ||||||||
Common Name | VIT_15s0046g00240 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 154aa MW: 17318.8 Da PI: 6.2533 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 106.2 | 2.6e-33 | 2 | 94 | 8 | 100 |
DUF260 8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 lrr+C +dC+lapyfp+ + +kfa vhk+FGasnv+k+++ ++e++reda+++++yeA r+rdPvyG++g i++lq+ ++ l+++l+++++ GSVIVT01027172001 2 LRRRCDRDCILAPYFPSYEIEKFAGVHKVFGASNVIKMIQMVEESRREDAVKAIIYEATTRLRDPVYGSAGAIFHLQKMIQDLNTQLDSIRT 93 89************************************************************************************998877 PP DUF260 100 e 100 + GSVIVT01027172001 94 Q 94 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 21.525 | 1 | 95 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.7E-33 | 1 | 92 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MLRRRCDRDC ILAPYFPSYE IEKFAGVHKV FGASNVIKMI QMVEESRRED AVKAIIYEAT 60 TRLRDPVYGS AGAIFHLQKM IQDLNTQLDS IRTQTLVLRE QRDQLLGILK NVHRRDPVSP 120 IDFPTFGDAG SLSIDDTVGC GPSSFPSDCD WIL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-30 | 1 | 108 | 17 | 122 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-30 | 1 | 108 | 17 | 122 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.6653 | 0.0 | fruit |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM453733 | 0.0 | AM453733.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X087152.2, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002265542.1 | 1e-111 | PREDICTED: LOB domain-containing protein 1 | ||||
TrEMBL | A0A438IFC0 | 1e-110 | A0A438IFC0_VITVI; LOB domain-containing protein 11 | ||||
STRING | VIT_15s0046g00240.t01 | 1e-110 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP13259 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 5e-38 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01027172001 |