PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01026969001 | ||||||||
Common Name | LOC100267186, VIT_15s0046g02150 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 202aa MW: 22617.8 Da PI: 9.5816 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101 | 7.2e-32 | 122 | 180 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s +prsYYrCt+++C vkk+v+r ++d++vv++tYeg Hnh+ GSVIVT01026969001 122 LDDGYRWRKYGQKAVKNSIYPRSYYRCTHHTCDVKKQVQRLSKDTSVVVTTYEGIHNHP 180 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.6E-32 | 108 | 180 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.41E-28 | 116 | 181 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.541 | 117 | 182 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.6E-37 | 122 | 181 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.1E-25 | 123 | 180 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MDGDGDHAPP PPPPPLLPLP SQASSFLFTP SLPSSSMHPH LQLPPPPLPP LQAQILGDID 60 WATLLSAQTG LSDLYPRAEG TSSVMAEEEK GSIKDRRKGV RTTRKATRPR FAFQTRSVDD 120 ILDDGYRWRK YGQKAVKNSI YPRSYYRCTH HTCDVKKQVQ RLSKDTSVVV TTYEGIHNHP 180 CEKLMETLSP LLKQIQFLSR F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-24 | 112 | 179 | 7 | 74 | Probable WRKY transcription factor 4 |
2ayd_A | 5e-24 | 110 | 179 | 2 | 71 | WRKY transcription factor 1 |
2lex_A | 5e-24 | 112 | 179 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.29187 | 0.0 | root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM425490 | 0.0 | AM425490.2 Vitis vinifera contig VV78X038611.6, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275528.3 | 1e-147 | PREDICTED: probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 2e-54 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A438JLT2 | 1e-146 | A0A438JLT2_VITVI; Putative WRKY transcription factor 24 | ||||
TrEMBL | D7UCE6 | 1e-146 | D7UCE6_VITVI; Uncharacterized protein | ||||
STRING | VIT_15s0046g02150.t01 | 1e-147 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 5e-58 | WRKY DNA-binding protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01026969001 |
Entrez Gene | 100267186 |