PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024933001
Common NameLOC100257123, VIT_06s0004g04970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 501aa    MW: 57256.8 Da    PI: 8.457
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024933001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1971.1e-601463412199
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                          lL++cA+av++ ++++a+ +L+ +++++sp g+  qRla++f++ L+arla+++ ++y al++++ts   ++++++a++l++ ++P+ ++
  GSVIVT01024933001 146 NALLIQCAQAVAAYNQRAANDILKLIRQHSSPFGNGSQRLAHFFANSLEARLAGTGLQMYTALATKRTS---VADVIKAYQLYVSACPFKRM 234
                        579************************************************************999999...******************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s+  aN+ I + +eg++r+HiiDf++ +G+QWp+L+q L+ Rp+gpp+lRiTg++ p++g   +e++eetg+rLa+++++++vpfe+++ +a
  GSVIVT01024933001 235 SNRYANRVIAKLAEGATRLHIIDFGVLYGFQWPCLIQFLSLRPGGPPKLRITGIDFPQPGfrPAERVEETGRRLANYCKRFKVPFEYKA-IA 325
                        ***********************************************************9*****************************.7* PP

               GRAS 184 krledleleeLrvkpg 199
                        +r+e++++e+L+++++
  GSVIVT01024933001 326 QRWETIKVEDLEIDRD 341
                        ************9986 PP

2GRAS134.79.7e-42345495224374
               GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                        +d+vL+l+++++P+++++   + + n++ F++rf eal ++ alfd+l+a++pre+e r++ Ere+ g++i+n++aceg+er+er   +++W
  GSVIVT01024933001 345 KDAVLELIRRINPDIFIHGVLNGNFNTPFFFTRFREALFHFDALFDMLDASVPREDEGRMMFEREIYGKDIMNIIACEGSERIERPDIYKQW 436
                        479***************************************************************************************** PP

               GRAS 316 rerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        ++r e+aG++++pl++++ ++++ ++++ + + + ve + g+++ gWk+r ++++S+W+
  GSVIVT01024933001 437 QARNERAGLRQLPLEQEILMKVRNIVKMDYHKDFVVEVDGGWMLHGWKGRVIYAISCWK 495
                        ******************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.29119475IPR005202Transcription factor GRAS
PfamPF035143.9E-58146341IPR005202Transcription factor GRAS
PfamPF035143.4E-39345495IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MDSIPRKFSG SKNGQKLYHE SVSINSDHNV VERFMDPPFL PTKSHPYNSA TVSGARLEED  60
SAEDCELSIA MLKYMGEILM EDELEDKNCM FQDCVALLAA EKSFYDLGQL EASRKKLHQN  120
EQSKGSNGKA GRVKKKHNKG ELVDLNALLI QCAQAVAAYN QRAANDILKL IRQHSSPFGN  180
GSQRLAHFFA NSLEARLAGT GLQMYTALAT KRTSVADVIK AYQLYVSACP FKRMSNRYAN  240
RVIAKLAEGA TRLHIIDFGV LYGFQWPCLI QFLSLRPGGP PKLRITGIDF PQPGFRPAER  300
VEETGRRLAN YCKRFKVPFE YKAIAQRWET IKVEDLEIDR DGCLKDAVLE LIRRINPDIF  360
IHGVLNGNFN TPFFFTRFRE ALFHFDALFD MLDASVPRED EGRMMFEREI YGKDIMNIIA  420
CEGSERIERP DIYKQWQARN ERAGLRQLPL EQEILMKVRN IVKMDYHKDF VVEVDGGWML  480
HGWKGRVIYA ISCWKPCHHL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A4e-511284961379Protein SCARECROW
5b3h_D4e-511284961379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4428050.0AM442805.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X005019.10, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019075956.10.0PREDICTED: scarecrow-like protein 33
SwissprotQ9XE581e-160SCL14_ARATH; Scarecrow-like protein 14
TrEMBLF6GV000.0F6GV00_VITVI; Uncharacterized protein
STRINGVIT_06s0004g04970.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-145SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]