PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01024931001
Common NameVIT_06s0004g04990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 379aa    MW: 43613.2 Da    PI: 9.2976
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01024931001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS83.53.7e-2610718475152
               GRAS  75 seelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspes 152
                        ++ + a+k++  ++P+ ++s++  N +I + +e+++r+HiiDf+i  G+QWp+++q L++Rp+gpp+lRiTg++ p++
  GSVIVT01024931001 107 ADIIRAYKVYASACPFKRMSYFFGNWMIGKVAEKATRLHIIDFGILFGFQWPSFIQHLSQRPGGPPRLRITGIDFPQP 184
                        67899********************************************************************99876 PP

2GRAS1641.3e-50185376183374
               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a+++e+++le+L+++++E+l+Vn+ ++l++llde+v  + +rd+vL+l+++++P+++++     + n++ Fl rf eal+ y alfd+l+a+
  GSVIVT01024931001 185 AEKWENIRLEDLKIDKDEKLVVNSLYRLKNLLDETVVEDCPRDAVLNLIRRINPEIFIHGIVSGSFNGPFFLLRFKEALHQYDALFDMLDAT 276
                        5799********************************9999**************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +pre+++r+  E+++ gr  +n++a+eg+er+er et+++W++r  +aGF+++ l++++ + +++ +++   + ++vee+ g++++gWk+r+
  GSVIVT01024931001 277 VPREDQDRMLFEKVVYGRYSMNIIAHEGSERFERPETYKQWQARNVKAGFRQLLLDQEILSRVRTTVKQGFHKNFMVEEDGGWMLQGWKGRT 368
                        ******************************************************************99877788****************** PP

               GRAS 367 LvsvSaWr 374
                        + ++S+W+
  GSVIVT01024931001 369 IHALSCWK 376
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.3531356IPR005202Transcription factor GRAS
PfamPF035141.3E-23107184IPR005202Transcription factor GRAS
PfamPF035144.4E-48185376IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MAVHAQNSEP PNVFDEALLY NDLNMSKLCI NDDEASKKLQ QNERSKGSNT KVGRVKRRSK  60
GEVVDLRSLL IQCAQAVAGN DQRAATELLK LIRQHSSPMG IERPLAADII RAYKVYASAC  120
PFKRMSYFFG NWMIGKVAEK ATRLHIIDFG ILFGFQWPSF IQHLSQRPGG PPRLRITGID  180
FPQPAEKWEN IRLEDLKIDK DEKLVVNSLY RLKNLLDETV VEDCPRDAVL NLIRRINPEI  240
FIHGIVSGSF NGPFFLLRFK EALHQYDALF DMLDATVPRE DQDRMLFEKV VYGRYSMNII  300
AHEGSERFER PETYKQWQAR NVKAGFRQLL LDQEILSRVR TTVKQGFHKN FMVEEDGGWM  360
LQGWKGRTIH ALSCWKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-307237725380Protein SCARECROW
5b3h_A5e-307237724379Protein SCARECROW
5b3h_D5e-307237724379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4692910.0AM469291.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X259333.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019075847.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE581e-118SCL14_ARATH; Scarecrow-like protein 14
TrEMBLF6GUZ80.0F6GUZ8_VITVI; Uncharacterized protein
STRINGVIT_06s0004g04990.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-120SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]