PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01024662001 | ||||||||
Common Name | LOC100251897, VIT_06s0004g07200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 164aa MW: 18235.8 Da PI: 6.8947 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 143.5 | 6.3e-45 | 6 | 105 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ GSVIVT01024662001 6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRIDAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQM 97 7******************************************************************************************* PP DUF260 93 elallkee 100 +la++++e GSVIVT01024662001 98 QLAVAQTE 105 ***99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.974 | 5 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.4E-44 | 6 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009965 | Biological Process | leaf morphogenesis |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MGGSSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVHQRI 60 DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQTEILCIQ MQQEEPALPT 120 QMDQDEKSLL LSNNSFNNLQ HYLSFASSSN VIQDPLKRES LWT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-50 | 2 | 119 | 7 | 127 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-50 | 2 | 119 | 7 | 127 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ378626 | 0.0 | FQ378626.1 Vitis vinifera clone SS0AEB13YA05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002278121.2 | 1e-119 | PREDICTED: LOB domain-containing protein 12 | ||||
Refseq | XP_019075938.1 | 1e-119 | PREDICTED: LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 5e-81 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | D7SJR8 | 1e-118 | D7SJR8_VITVI; Uncharacterized protein | ||||
STRING | VIT_06s0004g07200.t01 | 1e-119 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 4e-80 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01024662001 |
Entrez Gene | 100251897 |
Publications ? help Back to Top | |||
---|---|---|---|
|