PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01023123001 | ||||||||
Common Name | VIT_12s0035g02020 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 205aa MW: 24138.6 Da PI: 10.067 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162.5 | 1.5e-50 | 38 | 163 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 +pGfrFhPt+eelv +yL++kvegk++++ e i+++d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + GSVIVT01023123001 38 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITSLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIR 128 79***************************.89***************8778899************************************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ + +glkktLvfy+g+apkg +t+W+m+eyrl GSVIVT01023123001 129 TENFRPIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 163 *********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.96E-56 | 37 | 183 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.858 | 37 | 184 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-25 | 39 | 163 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MTVEERSKGT AKVGVFMAIA ANMSQEDNKD EHEHDMVMPG FRFHPTEEEL VEFYLRRKVE 60 GKRFNVELIT SLDLYRYDPW ELPALAAIGE KEWFFYVPRD RKYRNGDRPN RVTTSGYWKA 120 TGADRMIRTE NFRPIGLKKT LVFYSGKAPK GIRTSWIMNE YRLPQQETER SQKAEISLCR 180 VYKRAGVEDH PSLPRSLPKW KWRK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-57 | 39 | 184 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-57 | 39 | 184 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-57 | 39 | 184 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-57 | 39 | 184 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
4dul_A | 2e-57 | 39 | 184 | 19 | 165 | NAC domain-containing protein 19 |
4dul_B | 2e-57 | 39 | 184 | 19 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.19011 | 0.0 | cell culture |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in aerial organs in early stages of seedling development. {ECO:0000269|PubMed:17653269}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00257 | DAP | Transfer from AT2G02450 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM489353 | 1e-147 | AM489353.2 Vitis vinifera contig VV78X021393.26, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002271971.1 | 1e-135 | PREDICTED: NAC domain-containing protein 35 | ||||
Swissprot | Q9ZVP8 | 1e-109 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | F6HJY7 | 1e-144 | F6HJY7_VITVI; Uncharacterized protein | ||||
STRING | VIT_12s0035g02020.t01 | 1e-145 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 1e-111 | NAC domain containing protein 35 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01023123001 |
Publications ? help Back to Top | |||
---|---|---|---|
|