PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01022613001 | ||||||||
Common Name | VIT_02s0033g00050 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 95aa MW: 10354.8 Da PI: 4.6403 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 45.1 | 1.7e-14 | 44 | 93 | 1 | 50 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALa 50 l++lLl+cA++v+s++le+ + +++++s+las dgd+mq +aayft+ALa GSVIVT01022613001 44 LIHLLLTCANHVASSSLENMNIAMEQISQLASVDGDTMQCIAAYFTKALA 93 689**********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 9.969 | 18 | 94 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 5.7E-12 | 44 | 93 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MDERSSSVTS SPLQLFSMMS HSPSLGSPYP WLRELKSEER GLYLIHLLLT CANHVASSSL 60 ENMNIAMEQI SQLASVDGDT MQCIAAYFTK ALAD* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM454128 | 1e-146 | AM454128.2 Vitis vinifera contig VV78X093241.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002266911.3 | 2e-51 | PREDICTED: scarecrow-like protein 3 | ||||
Swissprot | Q9LPR8 | 1e-33 | SCL3_ARATH; Scarecrow-like protein 3 | ||||
TrEMBL | D7U3Q1 | 1e-62 | D7U3Q1_VITVI; Uncharacterized protein | ||||
STRING | VIT_02s0033g00050.t01 | 2e-63 | (Vitis vinifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G50420.1 | 6e-36 | scarecrow-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01022613001 |
Publications ? help Back to Top | |||
---|---|---|---|
|