PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01021622001 | ||||||||
Common Name | LOC100249692, VIT_10s0003g04650 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 209aa MW: 22647.9 Da PI: 7.867 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.2 | 5.5e-33 | 113 | 169 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k+ ksrkpylheSRh hAlrR+Rg+gGrF GSVIVT01021622001 113 EEPVFVNAKQYHGILRRRQSRAKAESENKV-VKSRKPYLHESRHLHALRRARGCGGRF 169 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.9E-37 | 111 | 172 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.986 | 112 | 172 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 5.5E-28 | 114 | 169 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.1E-23 | 115 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 117 | 137 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.1E-23 | 146 | 169 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MTSSVHDLSD NSEADEPQKH SELQVQSSSP AAGASHPGSA AANIPYATPP QLGAGHAMAQ 60 AAYPYPDPYY RSIFAPYDAQ PYPAQHYSGQ PMVHLQLMGI QQAGVPLPSD AVEEPVFVNA 120 KQYHGILRRR QSRAKAESEN KVVKSRKPYL HESRHLHALR RARGCGGRFL NSKKNESEQN 180 EVASGDKSQS NINLNSDKNE LASSDSTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 5e-22 | 112 | 177 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.6356 | 0.0 | bud| flower| fruit| inflorescence |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM472177 | 4e-94 | AM472177.2 Vitis vinifera contig VV78X243821.10, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010655736.1 | 1e-152 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 1e-72 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | D7TKH6 | 1e-150 | D7TKH6_VITVI; Uncharacterized protein | ||||
STRING | VIT_10s0003g04650.t01 | 1e-151 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP680 | 16 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 1e-60 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01021622001 |
Entrez Gene | 100249692 |
Publications ? help Back to Top | |||
---|---|---|---|
|