PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01021303001 | ||||||||
Common Name | VIT_10s0003g02070 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 227aa MW: 26194.5 Da PI: 9.8596 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.5 | 1.3e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ GSVIVT01021303001 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 58 79***********************************************8 PP | |||||||
2 | K-box | 117.1 | 1.6e-38 | 77 | 173 | 5 | 100 |
K-box 5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 s++ ++ea+a+ +qqe++kL ++i+nLq+++Rh+lGe+L+sL++k+L++Le +Lek++++iRs+Knell+++ie++qk+e +l+++n++Lr GSVIVT01021303001 77 SNTGsVSEANAQFYQQESSKLHQQIRNLQNSNRHMLGESLGSLNFKDLKSLEIRLEKGISRIRSRKNELLFAEIEYMQKREIDLHNDNQYLR 168 344459************************************************************************************** PP K-box 96 kklee 100 ++++e GSVIVT01021303001 169 ARIAE 173 *9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.132 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.95E-46 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-33 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.7E-29 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.496 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANN 60 SVKSTIERYK KASADSSNTG SVSEANAQFY QQESSKLHQQ IRNLQNSNRH MLGESLGSLN 120 FKDLKSLEIR LEKGISRIRS RKNELLFAEI EYMQKREIDL HNDNQYLRAR IAENERNEQQ 180 MSLMPGGANY ELMPSQQFDS RNYFQLNGLQ PNQSYSRQDQ PALQLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.7957 | 0.0 | bud| flower| fruit| inflorescence| pedicel |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Flower. Preferentially expressed in stamen and carpel and weakly in petal. Undetected in leaves and roots. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF209334 | 0.0 | EF209334.1 Vitis labrusca x Vitis vinifera AGAMOUS-like MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001268097.1 | 1e-165 | agamous | ||||
Swissprot | Q40872 | 1e-135 | AG_PANGI; Floral homeotic protein AGAMOUS | ||||
TrEMBL | D7TJT8 | 1e-164 | D7TJT8_VITVI; Uncharacterized protein | ||||
STRING | VIT_10s0003g02070.t01 | 1e-165 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-126 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01021303001 |