PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01019810001 | ||||||||
Common Name | VIT_02s0025g04000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 151aa MW: 17294.4 Da PI: 4.7268 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 153.7 | 1.7e-47 | 1 | 135 | 241 | 374 |
GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332 ++eqea+hn+ s+ +r++++l+yysa+fds++ +lp +s r+kvE++ ++rei+n++aceg++r+erhe++ekWr+r+e+ GF+ v +se+ GSVIVT01019810001 1 MAEQEAEHNELSLETRVSNSLRYYSAIFDSIDYSLPLDSPVRMKVEEM-FAREIRNIIACEGSDRVERHESFEKWRRRMEQGGFRCVGISER 91 68**********************************************.******************************************* PP GRAS 333 aakqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374 ++ q ++ll++++ + y+v ++ +++l+l W d+pL++vSaW+ GSVIVT01019810001 92 EMLQSQMLLKMYSCENYSVSKRgqDAALTLSWLDQPLYTVSAWT 135 *************999****886578888**************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 5.8E-45 | 1 | 135 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 19.667 | 1 | 113 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MAEQEAEHNE LSLETRVSNS LRYYSAIFDS IDYSLPLDSP VRMKVEEMFA REIRNIIACE 60 GSDRVERHES FEKWRRRMEQ GGFRCVGISE REMLQSQMLL KMYSCENYSV SKRGQDAALT 120 LSWLDQPLYT VSAWTQVDVA GSSSSFSLPS * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 5e-18 | 1 | 135 | 248 | 379 | Protein SCARECROW |
5b3h_A | 5e-18 | 1 | 135 | 247 | 378 | Protein SCARECROW |
5b3h_D | 5e-18 | 1 | 135 | 247 | 378 | Protein SCARECROW |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots and sepals. {ECO:0000269|PubMed:18500650}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM432666 | 0.0 | AM432666.2 Vitis vinifera contig VV78X204484.5, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002276880.1 | 1e-102 | PREDICTED: scarecrow-like protein 28 isoform X1 | ||||
Refseq | XP_019072644.1 | 1e-102 | PREDICTED: scarecrow-like protein 28 isoform X2 | ||||
Swissprot | Q9CAN3 | 5e-48 | SCL28_ARATH; Scarecrow-like protein 28 | ||||
TrEMBL | A0A438JJQ7 | 1e-106 | A0A438JJQ7_VITVI; Scarecrow-like protein 28 | ||||
STRING | VIT_02s0025g04000.t01 | 1e-101 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5507 | 15 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63100.1 | 2e-50 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01019810001 |