PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01018446001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 204aa MW: 23426.5 Da PI: 5.5271 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.3 | 1.3e-30 | 3 | 52 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye+ss GSVIVT01018446001 3 RIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 52 8***********************************************96 PP | |||||||
2 | K-box | 70.2 | 6.7e-24 | 73 | 163 | 8 | 97 |
K-box 8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 + e+ +++l+q+++ + k+ie L+ +qR+llG++L+s+sl e+ ++ +qLekslk+iR++K +++ eqieel+++ek+l een +L++k GSVIVT01018446001 73 NpELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGLSSCSLDEILEIDSQLEKSLKSIRARKAQIFQEQIEELKEREKQLLEENARLSQK 163 33678899*********************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 1.29E-29 | 1 | 68 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.14E-37 | 1 | 65 | No hit | No description |
SMART | SM00432 | 3.4E-32 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.1 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-27 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-18 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-18 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.5E-23 | 80 | 163 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.983 | 80 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MRRIENATSR QVTFSKRRNG LLKKAYELSV LCDAEVAVII FSQKGRLYEF SSSNMQSAIE 60 RYREHAKQVE TNNPELEQYM QNLKQDAESM AKKIELLEVS QRKLLGQGLS SCSLDEILEI 120 DSQLEKSLKS IRARKAQIFQ EQIEELKERE KQLLEENARL SQKDTRQWQL SAQPSEGVTY 180 SQSSPSSEVE TELFIGLPEM RCS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-18 | 3 | 77 | 10 | 86 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.16378 | 1e-135 | bud| leaf| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM451651 | 5e-84 | AM451651.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X037174.6, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010662337.1 | 1e-145 | PREDICTED: MADS-box protein AGL42 | ||||
Refseq | XP_010662338.1 | 1e-145 | PREDICTED: MADS-box protein AGL42 | ||||
Refseq | XP_010662341.1 | 1e-145 | PREDICTED: MADS-box protein AGL42 | ||||
Refseq | XP_010662342.1 | 1e-145 | PREDICTED: MADS-box protein AGL42 | ||||
Swissprot | Q9FIS1 | 1e-83 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | F6HAQ2 | 1e-99 | F6HAQ2_VITVI; Uncharacterized protein | ||||
STRING | VIT_16s0022g02380.t01 | 1e-100 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 5e-75 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01018446001 |