PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01017741001 | ||||||||
Common Name | VIT_05s0020g01350 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 139aa MW: 15389.1 Da PI: 4.8782 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.6 | 2.1e-54 | 17 | 112 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 +eqdr+lPianvsrimk++lP+nakisk+aket+qecvsefisfvt+eas+kc++e+rkt+ngdd++wala lGf+dy+ plk yl++yrel GSVIVT01017741001 17 KEQDRLLPIANVSRIMKQTLPTNAKISKEAKETMQECVSEFISFVTGEASEKCKKERRKTVNGDDICWALAALGFDDYAGPLKRYLQRYREL 108 89****************************************************************************************** PP NF-YB 94 egek 97 eg++ GSVIVT01017741001 109 EGDR 112 **97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.6E-52 | 12 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.15E-38 | 19 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.9E-28 | 22 | 86 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-17 | 50 | 68 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.7E-17 | 69 | 87 | No hit | No description |
PRINTS | PR00615 | 1.7E-17 | 88 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0004709 | anatomy | axillary bud | ||||
PO:0025531 | developmental stage | bud swell stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MVDNPGASAS TDDGSIKEQD RLLPIANVSR IMKQTLPTNA KISKEAKETM QECVSEFISF 60 VTGEASEKCK KERRKTVNGD DICWALAALG FDDYAGPLKR YLQRYRELEG DRVLNQEKAG 120 NTEENDEPSS CRGSQPRN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-44 | 16 | 107 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-44 | 16 | 107 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM485704 | 0.0 | AM485704.2 Vitis vinifera contig VV78X028192.11, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019075476.1 | 1e-99 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 6e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | D7T6E2 | 3e-98 | D7T6E2_VITVI; Uncharacterized protein | ||||
STRING | VIT_05s0020g01350.t01 | 5e-99 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-59 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01017741001 |
Publications ? help Back to Top | |||
---|---|---|---|
|