PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01016765001 | ||||||||
Common Name | LOC100249722, VIT_09s0002g01380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 204aa MW: 23309.5 Da PI: 8.7472 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.7 | 1.5e-19 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l+++++ +G ++Wk Ia t g++R++k+c++rw +yl GSVIVT01016765001 21 RGAWTAEEDRKLAEVIEVHGAKRWKMIATTAGLNRCGKSCRLRWMNYL 68 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.7 | 4e-16 | 74 | 119 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l GSVIVT01016765001 74 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 119 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.029 | 16 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.41E-30 | 19 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-14 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.3E-17 | 21 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-25 | 22 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.32E-10 | 23 | 68 | No hit | No description |
PROSITE profile | PS51294 | 20.918 | 73 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-14 | 74 | 119 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-25 | 76 | 124 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.05E-10 | 78 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MAEKEVKSIG SVKDVRKEMN RGAWTAEEDR KLAEVIEVHG AKRWKMIATT AGLNRCGKSC 60 RLRWMNYLRP NIKRGNISDQ EEDLILRLHK LLGNRWSLIA GRLPGRTDNE IKNYWNSHLS 120 KKIKQEKQSG GSTRGCSKLQ RTRVVEEVNV VEVKREDTSN GGDQCSKMSF NVDEFFDFSE 180 EGPLNLEWVS QFLELDEGLC HPS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-29 | 18 | 123 | 4 | 108 | B-MYB |
1h8a_C | 2e-29 | 18 | 123 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM468035 | 0.0 | AM468035.1 Vitis vinifera contig VV78X155042.5, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002273991.1 | 1e-149 | PREDICTED: transcription factor MYB114 | ||||
Swissprot | Q9SEI0 | 7e-53 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | D7TZT2 | 1e-147 | D7TZT2_VITVI; Uncharacterized protein | ||||
STRING | VIT_09s0002g01380.t01 | 1e-148 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 1e-53 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01016765001 |
Entrez Gene | 100249722 |