PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01016329001 | ||||||||
Common Name | VIT_13s0019g03800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 148aa MW: 16104.7 Da PI: 8.4171 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 121.2 | 5.5e-38 | 61 | 147 | 1 | 87 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 +CaaCkvlrr+C ++C+lapyfp ++p kf n+hk+FGasn+ k l++lp+ +r da+ss+vyeA+ar+rdPvyG++g+i +l++ql GSVIVT01016329001 61 PCAACKVLRRRCDESCILAPYFPPNEPLKFINAHKVFGASNIAKALQELPQPTRADAVSSMVYEANARIRDPVYGCAGTICHLHKQL 147 7**********************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.745 | 60 | 147 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.9E-38 | 61 | 147 | IPR004883 | Lateral organ boundaries, LOB |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0025242 | anatomy | infructescence axis | ||||
PO:0007017 | developmental stage | sporophyte senescent stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MYAFCMCIQP QAPHCLLAAL RMEYADIDKT TRPLAVSCIP FSSSSPSSSR FSPPPTAFQG 60 PCAACKVLRR RCDESCILAP YFPPNEPLKF INAHKVFGAS NIAKALQELP QPTRADAVSS 120 MVYEANARIR DPVYGCAGTI CHLHKQL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-36 | 61 | 147 | 11 | 97 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-36 | 61 | 147 | 11 | 97 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM432103 | 1e-178 | AM432103.2 Vitis vinifera contig VV78X059104.10, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275051.1 | 3e-68 | PREDICTED: LOB domain-containing protein 1 | ||||
Swissprot | Q9LQR0 | 5e-43 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
TrEMBL | D7TMD9 | 1e-103 | D7TMD9_VITVI; Uncharacterized protein | ||||
STRING | VIT_13s0019g03800.t01 | 1e-104 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 3e-45 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01016329001 |