PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01016328001 | ||||||||
Common Name | VIT_13s0019g03810 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 140aa MW: 15609 Da PI: 8.2766 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 136.7 | 8.2e-43 | 12 | 111 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaC++lrr+C+++C+lapyfp ++p kf n+hk+FGasn++k l++lp+ +r da+ss+vyeA+ar+rdPvyG++g+i++l++q++ lka GSVIVT01016328001 12 PCAACRFLRRRCNESCILAPYFPPNEPLKFINAHKVFGASNIVKALQELPQPKRVDAVSSMVYEANARIRDPVYGCAGTISQLHKQVNDLKA 103 7******************************************************************************************* PP DUF260 93 elallkee 100 ela++++e GSVIVT01016328001 104 ELAMAQAE 111 ****9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.643 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.7E-42 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0025242 | anatomy | infructescence axis | ||||
PO:0007017 | developmental stage | sporophyte senescent stage | ||||
PO:0007089 | developmental stage | stem elongation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MFSPPSTAFQ GPCAACRFLR RRCNESCILA PYFPPNEPLK FINAHKVFGA SNIVKALQEL 60 PQPKRVDAVS SMVYEANARI RDPVYGCAGT ISQLHKQVND LKAELAMAQA ELFIMQCQQQ 120 QQNANASFFL DRYLVSDYC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-43 | 5 | 119 | 3 | 118 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-43 | 5 | 119 | 3 | 118 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM469818 | 1e-136 | AM469818.2 Vitis vinifera contig VV78X059104.8, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275051.1 | 1e-100 | PREDICTED: LOB domain-containing protein 1 | ||||
Swissprot | Q9LQR0 | 9e-50 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
TrEMBL | D7TMD8 | 2e-98 | D7TMD8_VITVI; Uncharacterized protein | ||||
STRING | VIT_13s0019g03810.t01 | 3e-99 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 4e-51 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01016328001 |