PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01015575001 | ||||||||
Common Name | LOC100244125, VIT_11s0016g05660 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 224aa MW: 25436.7 Da PI: 9.0503 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.3 | 5.6e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W +eEd+ll+++v+ +G g W+t++++ g++R +k+c++rw +yl GSVIVT01015575001 15 KGLWKPEEDLLLKKYVEAHGEGKWATVSERSGLKRGGKSCRLRWKNYL 62 678*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.4 | 1.2e-16 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l GSVIVT01015575001 68 RGEISKEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 113 78889*****************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.75 | 10 | 66 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-22 | 10 | 65 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.66E-28 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-14 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.20E-9 | 18 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.4E-24 | 66 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-17 | 67 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.517 | 67 | 117 | IPR017930 | Myb domain |
Pfam | PF00249 | 5.7E-15 | 68 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.51E-12 | 72 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MEETGGLVPK PSVKKGLWKP EEDLLLKKYV EAHGEGKWAT VSERSGLKRG GKSCRLRWKN 60 YLRPNIKRGE ISKEEEDLII RMHKLLGNRW SLIAGRLPGR TDNEVKNYWN THLNKGRSRG 120 KRKSPSSDDD AGNKRHRGLP NSQPVCDGSP EKSSEGSEGR KEEESHNILD NNPRMEDTKS 180 LNHDIKSPLP PSVEDTAFLF YAEPFISFPD PFVLFETLGE MEW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-23 | 8 | 115 | 20 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in the trichomes of new leaves. {ECO:0000269|PubMed:24803498}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM476211 | 0.0 | AM476211.2 Vitis vinifera contig VV78X035166.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002282342.1 | 1e-162 | PREDICTED: transcription factor MYB82 | ||||
Swissprot | Q9LTF7 | 8e-66 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A438JQC5 | 1e-161 | A0A438JQC5_VITVI; Transcription factor MYB82 | ||||
TrEMBL | D7TC47 | 1e-161 | D7TC47_VITVI; Uncharacterized protein | ||||
STRING | VIT_11s0016g05660.t01 | 1e-162 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 1e-63 | myb domain protein 82 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01015575001 |
Entrez Gene | 100244125 |