PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01015100001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 188aa MW: 21680.6 Da PI: 10.9477 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.1 | 6.6e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ed++l +++k +G g+W+ +++ g++R++k+c++rw++yl GSVIVT01015100001 14 RGAWTVVEDKILTEYIKVHGEGRWRNLPKKAGLKRCGKSCRLRWLNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.2 | 2.9e-16 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E++l+v+++k+lG++ W++Ia +++ gRt++++k++w++ GSVIVT01015100001 67 RGNISHDEEDLIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111 78999*****************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.5E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.508 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.59E-28 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.45E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.045 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-23 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-14 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.34E-10 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MGRSPCCSKE GLNRGAWTVV EDKILTEYIK VHGEGRWRNL PKKAGLKRCG KSCRLRWLNY 60 LRPDIKRGNI SHDEEDLIVR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLVKKMQSRQ 120 TPGSSQSADR NKNKAKSMFL SLLFLFEIIN LLGESLITKK RLFLPTIIPP FLLLVRHTFH 180 TIICLFL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB911341 | 0.0 | AB911341.1 Vitis vinifera MYBPAR mRNA for R2R3 MYB transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003633091.1 | 7e-95 | PREDICTED: transcription factor TT2 | ||||
Swissprot | P10290 | 4e-63 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A5BS49 | 4e-95 | A5BS49_VITVI; Uncharacterized protein | ||||
STRING | VIT_11s0016g01300.t01 | 3e-94 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16720.1 | 1e-63 | myb domain protein 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01015100001 |