PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01014756001

Common Name

LOC100259989, VIT_19s0015g01170

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

MYB_related

Protein Properties

Length: 161aa MW: 18300.6 Da PI: 9.3866

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01014756001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.6	1.7e-14	81	125	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ ++++ ++G+g+Wk I+r+ ++Rt+ q+ s+ qky GSVIVT01014756001 81 PWTEEEHTWFLQGLLKFGKGDWKNISRHCVTTRTPTQVASHAQKY 125 7*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.51E-12	10	65	IPR009057	Homeodomain-like
PROSITE profile	PS51293	7.647	12	66	IPR017884	SANT domain
SMART	SM00717	2.5E-4	13	65	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-5	17	64	IPR009057	Homeodomain-like
CDD	cd00167	9.83E-5	17	63	No hit	No description
PROSITE profile	PS51294	18.588	74	130	IPR017930	Myb domain
TIGRFAMs	TIGR01557	1.2E-16	77	129	IPR006447	Myb domain, plants
SuperFamily	SSF46689	1.05E-17	77	131	IPR009057	Homeodomain-like
SMART	SM00717	2.7E-10	78	128	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.7E-11	78	125	IPR009057	Homeodomain-like
CDD	cd00167	1.05E-9	81	126	No hit	No description
Pfam	PF00249	9.2E-12	81	125	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MSFGYLDYSS SSARSGWTRS ENILLERAIL MFPEEIPDRW YKIANQIPGK STIDVLEHYI 60 KLIQDTDAID FGSMDWKKGA PWTEEEHTWF LQGLLKFGKG DWKNISRHCV TTRTPTQVAS 120 HAQKYFARQK SGNAEKRRKR SSIHDITTSD LHSPHGGAAS *

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM478727	1e-136	AM478727.1 Vitis vinifera contig VV78X086495.10, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002268293.2	1e-110	PREDICTED: transcription factor DIVARICATA
Swissprot	Q8S9H7	1e-42	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	F6I586	1e-108	F6I586_VITVI; Uncharacterized protein
STRING	VIT_19s0015g01170.t01	1e-109	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP275	17	122

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11280.2	2e-46	MYB family protein

Link Out ? help Back to Top
Phytozome	GSVIVT01014756001
Entrez Gene	100259989

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]