PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01013871001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 186aa MW: 20906.9 Da PI: 9.7513 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.8 | 6.7e-15 | 105 | 149 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE+ ++ + ++lG+g+W+ Ia+++ ++Rt+ q+ s+ qky GSVIVT01013871001 105 PWSEEEHRTFLAGLEKLGKGDWRGIAKKFVTTRTPTQVASHAQKY 149 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50158 | 8.664 | 7 | 22 | IPR001878 | Zinc finger, CCHC-type |
Gene3D | G3DSA:4.10.60.10 | 9.4E-4 | 8 | 31 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 16.209 | 100 | 154 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-10 | 102 | 152 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.15E-15 | 104 | 152 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.9E-12 | 104 | 149 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.3E-17 | 104 | 152 | IPR006447 | Myb domain, plants |
CDD | cd00167 | 4.46E-10 | 105 | 150 | No hit | No description |
Pfam | PF00249 | 1.2E-12 | 105 | 149 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MVKESVRKCS HCGNNGHNSR TCSAGGKGCL KLFGVQILTE KEDEAMRKSL SMGNLQSCNI 60 EHHHGDAGYL SDGLLQSRRG KQKYIEIGDF SSYEWISVCF CLGVPWSEEE HRTFLAGLEK 120 LGKGDWRGIA KKFVTTRTPT QVASHAQKYF LRRAACDKRK RRPSLFDMPL DPVLLHLSRN 180 RNHLA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00573 | DAP | Transfer from AT5G61620 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM454801 | 1e-161 | AM454801.2 Vitis vinifera contig VV78X076901.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002278155.2 | 1e-105 | PREDICTED: transcription factor MYB1R1 isoform X1 | ||||
Swissprot | Q9FKF9 | 3e-52 | M5162_ARATH; Probable transcription factor At5g61620 | ||||
TrEMBL | A0A438INP8 | 1e-104 | A0A438INP8_VITVI; Putative transcription factor | ||||
STRING | XP_008234449.1 | 1e-65 | (Prunus mume) | ||||
STRING | XP_010258761.1 | 7e-66 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP394 | 16 | 99 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 1e-54 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01013871001 |
Publications ? help Back to Top | |||
---|---|---|---|
|