PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01013684001 | ||||||||
Common Name | LOC100252776, VIT_18s0001g02210 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 196aa MW: 22878.7 Da PI: 6.2511 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.3 | 3.7e-08 | 12 | 58 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 r WT +d+++ +a + ++ + +W +Ia+ ++ g+t+++ k+++ GSVIVT01013684001 12 RTHWTRLDDKIFEQALAIFPEEmpdRWLSIAQQLP-GKTPEDMKLHYE 58 567*****************99*************.**********95 PP | |||||||
2 | Myb_DNA-binding | 40 | 9.1e-13 | 79 | 123 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+ E+ l++ + ++G+g+W++I+r++ +Rt+ q+ s+ qk+ GSVIVT01013684001 79 PWTEVEHRLFLSGLVRFGKGDWRSISRHVVITRTPTQVASHAQKF 123 8*****************************99***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.01E-11 | 7 | 73 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.4E-5 | 9 | 59 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 7.118 | 10 | 65 | IPR017884 | SANT domain |
SMART | SM00717 | 2.2E-6 | 11 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-6 | 12 | 58 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.46E-6 | 15 | 61 | No hit | No description |
PROSITE profile | PS51294 | 15.448 | 72 | 128 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-9 | 73 | 127 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.46E-15 | 74 | 129 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.0E-15 | 75 | 127 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 4.8E-10 | 76 | 126 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.4E-11 | 79 | 122 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.62E-8 | 79 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0007016 | developmental stage | whole plant flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MDCDPFPSQL IRTHWTRLDD KIFEQALAIF PEEMPDRWLS IAQQLPGKTP EDMKLHYELL 60 VEDVTNIENG NVERKKGTPW TEVEHRLFLS GLVRFGKGDW RSISRHVVIT RTPTQVASHA 120 QKFYLRQNSV KKERKRSSIH DINTIENFSP SDFPNNFSGQ QKDEVIDNLD NFSDLPNNFP 180 DQQQVNKFNL LKERE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 6e-16 | 15 | 72 | 11 | 68 | RADIALIS |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM454012 | 1e-167 | AM454012.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X149730.17, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002264197.1 | 1e-129 | PREDICTED: transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 4e-47 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | F6HJD1 | 1e-127 | F6HJD1_VITVI; Uncharacterized protein | ||||
STRING | VIT_18s0001g02210.t01 | 1e-128 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 5e-58 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01013684001 |
Entrez Gene | 100252776 |
Publications ? help Back to Top | |||
---|---|---|---|
|