PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01012778001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 188aa MW: 21657.1 Da PI: 10.7771 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.7 | 1.7e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd++l++++++ G g W++ ++ g+ R++k+c++rw +yl GSVIVT01012778001 14 RGSWSKEEDDRLIHYIRLNGHGFWRSLPKAAGLLRCGKSCRLRWINYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53.3 | 6.5e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++ +Edel+++++k+lG++ W++Ia +++ gRt++++k++w+++ GSVIVT01012778001 67 RGNFAIDEDELIIKLHKLLGNK-WSLIAGRLP-GRTDNEIKNHWNTH 111 6777789***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.6E-21 | 5 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.81 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.31E-27 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.6E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.38E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.551 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.6E-26 | 64 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.39E-11 | 73 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MGRKPCCDKA HTNRGSWSKE EDDRLIHYIR LNGHGFWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDVKRGNF AIDEDELIIK LHKLLGNKWS LIAGRLPGRT DNEIKNHWNT HIRRKLIMLF 120 VKFRTVTSNI SFLSNLKGLN CMDQSQHYLS KPQKNLLQKV ELENSNLSLN LSQGFTNPIK 180 SLPIPSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-28 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM442379 | 1e-101 | AM442379.2 Vitis vinifera contig VV78X123743.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010665255.1 | 1e-82 | PREDICTED: myb-related protein 308 | ||||
Swissprot | P81393 | 2e-71 | MYB08_ANTMA; Myb-related protein 308 | ||||
TrEMBL | F6GYT3 | 2e-81 | F6GYT3_VITVI; Uncharacterized protein | ||||
STRING | VIT_18s0117g00200.t01 | 3e-82 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 1e-72 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01012778001 |
Publications ? help Back to Top | |||
---|---|---|---|
|