PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01012149001 | ||||||||
Common Name | VIT_01s0011g01200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 209aa MW: 24604.3 Da PI: 9.9011 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60 | 5e-19 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd ll ++vk++G ++Wk Ia++ g++R++k+c++rw++yl GSVIVT01012149001 9 KGCWTQEEDSLLRKYVKEFGEENWKHIAAKSGLRRCRKSCRLRWLNYL 56 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.4 | 2.2e-15 | 62 | 107 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++Ed+l+ +++++lG++ W+ Ia +++ gRt++++k++w +yl GSVIVT01012149001 62 RGNFGADEDDLIMRLHRLLGNR-WSMIAGRIP-GRTPNEIKNYWKSYL 107 899*******************.*********.************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.318 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.25E-28 | 7 | 103 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-15 | 8 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.2E-17 | 9 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-23 | 11 | 63 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.52E-11 | 12 | 56 | No hit | No description |
PROSITE profile | PS51294 | 24.895 | 57 | 111 | IPR017930 | Myb domain |
SMART | SM00717 | 1.8E-13 | 61 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-14 | 62 | 107 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-23 | 64 | 111 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.64E-8 | 64 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MGCPTALRKG CWTQEEDSLL RKYVKEFGEE NWKHIAAKSG LRRCRKSCRL RWLNYLRPNI 60 KRGNFGADED DLIMRLHRLL GNRWSMIAGR IPGRTPNEIK NYWKSYLSKK IASETNKNSV 120 PVKHRTQSSA MDAERMGSAS ERKQGKEEEE DTVAFWRRLL SEAEYKEKFV WHDSCIPSIQ 180 VQLFWFLSYP SFLFLWMLWM ACDLSLNN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3zqc_A | 4e-25 | 9 | 127 | 2 | 119 | MYB3 |
3zqc_D | 4e-25 | 9 | 127 | 2 | 119 | MYB3 |
3zqc_G | 4e-25 | 9 | 127 | 2 | 119 | MYB3 |
3zqc_J | 4e-25 | 9 | 127 | 2 | 119 | MYB3 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.29632 | 0.0 | inflorescence |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM442854 | 1e-150 | AM442854.2 Vitis vinifera contig VV78X097044.5, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275704.1 | 1e-124 | PREDICTED: transcription factor MYB114 | ||||
Swissprot | Q9FNV9 | 4e-47 | MY113_ARATH; Transcription factor MYB113 | ||||
TrEMBL | D7T9Q3 | 1e-153 | D7T9Q3_VITVI; Uncharacterized protein | ||||
STRING | VIT_01s0011g01200.t01 | 1e-154 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66370.1 | 2e-49 | myb domain protein 113 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01012149001 |
Publications ? help Back to Top | |||
---|---|---|---|
|