PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01011768001 | ||||||||
Common Name | VIT_01s0011g04760 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 226aa MW: 25274.5 Da PI: 8.6906 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.7e-16 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d++++ G g+W+t ++ g+ R++k+c++rw +yl GSVIVT01011768001 13 KGAWSKQEDQKLIDYIRKNGEGCWRTLPQAAGLLRCGKSCRLRWINYL 60 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 66 | 111 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l GSVIVT01011768001 66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 8999******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-22 | 4 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.387 | 8 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.94E-28 | 11 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-12 | 12 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 13 | 60 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.30E-10 | 15 | 60 | No hit | No description |
PROSITE profile | PS51294 | 26.906 | 61 | 115 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-26 | 64 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-15 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-15 | 66 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.33E-11 | 68 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MRKPCCDKQD TNKGAWSKQE DQKLIDYIRK NGEGCWRTLP QAAGLLRCGK SCRLRWINYL 60 RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLINMGI 120 DPNNHRLSHN FPRPRDPCTA ATATSSGLNN HASPPVKSVG DNDQTSDAGS CLDDNRRALP 180 DLNLDVAITI PQPSLDTTEE AKKHNESKVS RELEPGPSST LLLFG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-29 | 10 | 115 | 4 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX050227 | 0.0 | JX050227.1 Vitis vinifera cultivar Maccabeu MybC2-L1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001268133.1 | 1e-165 | R2R3 Myb transcription factor C2 repressor motif protein | ||||
Swissprot | Q9SZP1 | 1e-75 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A438C1E8 | 1e-165 | A0A438C1E8_VITVI; Transcription repressor MYB4 | ||||
TrEMBL | D7T8U6 | 1e-165 | D7T8U6_VITVI; Uncharacterized protein | ||||
STRING | VIT_01s0011g04760.t01 | 1e-166 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 4e-78 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01011768001 |