PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01010625001 | ||||||||
Common Name | LOC100243436, VIT_16s0100g00440 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 154aa MW: 17235.6 Da PI: 8.9766 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 123.7 | 9.2e-39 | 4 | 104 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCk+lrr+C++dC+++ yfp+++p++fa vh+++Gasn+ k+l+++p++ r +a++s++yeA++r+ dPvyG v++i+ l+q+++++++ GSVIVT01010625001 4 RCAACKYLRRRCPPDCIFSSYFPSNDPQRFASVHRIYGASNIGKMLQQIPPHLRAEATESMYYEAQCRVADPVYGIVKTISLLNQEIHHAQS 95 6******************************************************************************************* PP DUF260 93 elallkeel 101 +la++++++ GSVIVT01010625001 96 QLAKVQAQI 104 *****9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.395 | 3 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.9E-39 | 4 | 101 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MNSRCAACKY LRRRCPPDCI FSSYFPSNDP QRFASVHRIY GASNIGKMLQ QIPPHLRAEA 60 TESMYYEAQC RVADPVYGIV KTISLLNQEI HHAQSQLAKV QAQIAFYNAQ VHGNNKIQNV 120 ELPSSNFNNS LANQGDAFPH PTLPLSIRPS WSM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-37 | 5 | 107 | 12 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-37 | 5 | 107 | 12 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM482489 | 1e-164 | AM482489.1 Vitis vinifera contig VV78X039920.5, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002274838.1 | 1e-112 | PREDICTED: LOB domain-containing protein 24 | ||||
Swissprot | P59468 | 6e-48 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | D7TMW8 | 1e-111 | D7TMW8_VITVI; Uncharacterized protein | ||||
STRING | VIT_16s0100g00440.t01 | 1e-111 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 3e-50 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01010625001 |
Entrez Gene | 100243436 |