PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01010525001 | ||||||||
Common Name | LOC100254080, VIT_01s0010g03930 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 190aa MW: 21258.9 Da PI: 9.3596 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.4 | 1.3e-32 | 110 | 168 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+ GSVIVT01010525001 110 LDDGYRWRKYGQKAVKNNRFPRSYYRCTHQGCNVKKQVQRLSKDEGIVVTTYEGMHSHQ 168 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.6E-34 | 95 | 168 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.7E-29 | 102 | 169 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.735 | 105 | 170 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.2E-38 | 110 | 169 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.5E-26 | 111 | 168 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MDSFSTLFPC PPSTSSPSPF SFLSMVNNSS HHDFQTHKPS DFLGLMSGTT ATAASMEVPA 60 SDITNVDSLQ AKGLLGSDDG EVKSCGKKKG EKKIRKPRYA FQTRSQVDIL DDGYRWRKYG 120 QKAVKNNRFP RSYYRCTHQG CNVKKQVQRL SKDEGIVVTT YEGMHSHQIE KSTDNFEHIL 180 SQMQVYASF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-28 | 100 | 169 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 5e-28 | 100 | 169 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.14004 | 0.0 | fruit| inflorescence |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM481102 | 0.0 | AM481102.2 Vitis vinifera contig VV79X000215.2, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275576.1 | 1e-142 | PREDICTED: probable WRKY transcription factor 75 | ||||
TrEMBL | D7TB08 | 1e-141 | D7TB08_VITVI; Uncharacterized protein | ||||
STRING | VIT_01s0010g03930.t01 | 1e-141 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 7e-58 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01010525001 |
Entrez Gene | 100254080 |