PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01010264001 | ||||||||
Common Name | LOC100249348, VIT_01s0010g01940 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 153aa MW: 16893.3 Da PI: 8.9164 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 143 | 7.3e-45 | 4 | 98 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +qd +lPianv+rimk++lP ak+sk+aketvqecvsef+ fvt+eas kc++e+r+t++ dd++wal+ lG++dy+ + yl+kyre+e+e GSVIVT01010264001 4 KQDLLLPIANVGRIMKQILPPGAKVSKEAKETVQECVSEFVKFVTGEASAKCRKEDRQTVTVDDICWALSALGLDDYAGATVRYLHKYREFERE 97 7999****************************************************************************************99 PP NF-YB 97 k 97 + GSVIVT01010264001 98 R 98 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.1E-42 | 3 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-33 | 5 | 102 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.1E-23 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.0E-9 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 1.0E-9 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 1.0E-9 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MADKQDLLLP IANVGRIMKQ ILPPGAKVSK EAKETVQECV SEFVKFVTGE ASAKCRKEDR 60 QTVTVDDICW ALSALGLDDY AGATVRYLHK YREFERERVN QKVQNEVHST RAKSGASNYK 120 CIQAGKQTET PTPLLLFKVT DQNGSSSLTK LS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-36 | 4 | 93 | 8 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM435987 | 0.0 | AM435987.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X051309.14, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010656509.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O82248 | 6e-46 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | D7TAH6 | 1e-109 | D7TAH6_VITVI; Uncharacterized protein | ||||
STRING | VIT_01s0010g01940.t01 | 1e-110 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-48 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01010264001 |
Entrez Gene | 100249348 |
Publications ? help Back to Top | |||
---|---|---|---|
|