PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01008980001 | ||||||||
Common Name | VIT_18s0001g04810 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 98aa MW: 11538.4 Da PI: 9.901 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 77.6 | 9.3e-25 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 rie+k rqv+fs+R++g++KKA+ELSvLCd+++a+i+f ++g+l +s GSVIVT01008980001 10 RIEDKATRQVSFSRRKKGLIKKAYELSVLCDIDIALIMFPPSGRLTQFS 58 8*********************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.5E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.46 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.76E-29 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-22 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-22 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-22 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009010 | anatomy | seed | ||||
PO:0025501 | developmental stage | fruit formation stage | ||||
PO:0025502 | developmental stage | fruit ripening stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MGRGKQEMRR IEDKATRQVS FSRRKKGLIK KAYELSVLCD IDIALIMFPP SGRLTQFSGK 60 KRMEEVFTRY MHLTDEEREE YALELLVQFA FERVWSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6byy_A | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM486084 | 7e-97 | AM486084.2 Vitis vinifera contig VV78X084760.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019071852.1 | 4e-59 | PREDICTED: agamous-like MADS-box protein AGL66 | ||||
Swissprot | Q1PFC2 | 1e-30 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | E0CRG3 | 1e-64 | E0CRG3_VITVI; Uncharacterized protein | ||||
STRING | VIT_18s0001g04810.t01 | 2e-65 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77950.2 | 2e-33 | AGAMOUS-like 67 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01008980001 |
Publications ? help Back to Top | |||
---|---|---|---|
|