PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01008402001

Common Name

LOC100250750, VIT_17s0000g02650

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

MYB

Protein Properties

Length: 166aa MW: 19284.2 Da PI: 10.7404

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01008402001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.7	1.3e-18	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l+d+++++G g+W++ ++ g+ R++k+c++rw++yl GSVIVT01008402001 13 KGAWSKEEDQKLIDYIQKHGEGSWRSLPQAAGLLRCGKSCRLRWLNYL 60 79****************************99**********97 PP
2	Myb_DNA-binding	53.7	4.9e-17	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++l GSVIVT01008402001 66 RGNFAEDEEDLIVKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 8999****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.7E-24	4	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.463	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	8.99E-30	11	107	IPR009057	Homeodomain-like
SMART	SM00717	5.0E-14	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-17	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	2.81E-10	15	60	No hit	No description
PROSITE profile	PS51294	26.757	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.2E-26	64	116	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-15	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	2.6E-15	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	5.84E-10	68	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 166 aa Download sequence Send to blast
MRKPCCEKKD TNKGAWSKEE DQKLIDYIQK HGEGSWRSLP QAAGLLRCGK SCRLRWLNYL 60 RPDLKRGNFA EDEEDLIVKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LKRKLIRMGI 120 NPDKHHVRQS ISRQHPVTPH GKKDQLSNDA TFLVKKTKRN RIKDI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-30	10	115	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.5258	0.0	bud\| fruit

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, flower buds, and siliques. {ECO:0000269\|PubMed:9839469}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM486116	1e-115	AM486116.2 Vitis vinifera contig VV78X041081.7, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010663664.1	1e-119	PREDICTED: transcription repressor MYB6 isoform X2
Swissprot	Q38851	2e-72	MYB6_ARATH; Transcription repressor MYB6
Swissprot	Q9SZP1	4e-72	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	D7SJ85	1e-118	D7SJ85_VITVI; Uncharacterized protein
STRING	VIT_17s0000g02650.t01	1e-119	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09460.1	8e-75	myb domain protein 6

Link Out ? help Back to Top
Phytozome	GSVIVT01008402001
Entrez Gene	100250750

Publications ? help Back to Top
Velasco R, et al. A high quality draft consensus sequence of the genome of a heterozygous grapevine variety. PLoS ONE, 2007. 2(12): p. e1326 [PMID:18094749] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]