PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01008401001 | ||||||||
Common Name | VIT_17s0000g02660, VITISV_005933 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 210aa MW: 23307.5 Da PI: 10.3327 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.8 | 1.1e-17 | 29 | 76 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++++G g+W++ ++ g+ R++k+c++rw +yl GSVIVT01008401001 29 KGAWSKQEDQKLIDYIQKHGEGCWSSLPQSAGLLRCGKSCRLRWVNYL 76 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53.6 | 5.3e-17 | 82 | 127 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l GSVIVT01008401001 82 RGNFGEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 127 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.383 | 24 | 76 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.69E-28 | 28 | 123 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.7E-14 | 28 | 78 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-16 | 29 | 76 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 30 | 83 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.23E-11 | 31 | 76 | No hit | No description |
PROSITE profile | PS51294 | 25.875 | 77 | 131 | IPR017930 | Myb domain |
SMART | SM00717 | 4.1E-16 | 81 | 129 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-15 | 82 | 127 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.97E-11 | 84 | 127 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.7E-26 | 84 | 131 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MVAMRKPAGY GEKKSTKKRV GCEKKFTNKG AWSKQEDQKL IDYIQKHGEG CWSSLPQSAG 60 LLRCGKSCRL RWVNYLKPDV KRGNFGEDEE DLIIKLHALL GNRWSLIAGR LPGRTDNEVK 120 NYWNSHLKKK LMRMGIDPNN HRLGERASGT SKSFESRDQT SNPLISAADN NAVLDSTCGS 180 ASKTTSSLPD LNLNLNVGAP SKNYPNKTQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-30 | 28 | 131 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GQ903730 | 0.0 | GQ903730.1 Vitis vinifera cultivar Cabernet Sauvignon R2R3 MYB transcription factor C2 motif repressor (MYBC2-L2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001268180.2 | 1e-145 | uncharacterized protein LOC100257749 | ||||
Swissprot | P81393 | 4e-71 | MYB08_ANTMA; Myb-related protein 308 | ||||
TrEMBL | A0A438KA11 | 1e-147 | A0A438KA11_VITVI; Transcription repressor MYB6 | ||||
TrEMBL | A5C8M7 | 1e-147 | A5C8M7_VITVI; Uncharacterized protein | ||||
STRING | VIT_17s0000g02660.t01 | 1e-147 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09460.1 | 6e-73 | myb domain protein 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01008401001 |
Publications ? help Back to Top | |||
---|---|---|---|
|