PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01008291001

Common Name

VIT_17s0000g03660

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

NAC

Protein Properties

Length: 328aa MW: 37083.7 Da PI: 8.4093

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01008291001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	181	3.1e-56	5	131	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeel+++yL++kv+++++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+ GSVIVT01008291001 5 LPPGFRFHPTDEELITYYLTPKVSNTNFAS-RAIADVDLNKCEPWDLPAKASMGEKEWYFFSLRDRKYPTGIRTNRATEAGYWKTTGKDKEI 95 79***********************999.89***********999999********************************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129 ++ g lvg+kktLvfykgrapkgek++Wvmheyrle GSVIVT01008291001 96 YR-AGILVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131 .999*****************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.27E-64	3	151	IPR003441	NAC domain
PROSITE profile	PS51005	60.503	5	151	IPR003441	NAC domain
Pfam	PF02365	3.7E-29	6	130	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 328 aa Download sequence Send to blast
MEESLPPGFR FHPTDEELIT YYLTPKVSNT NFASRAIADV DLNKCEPWDL PAKASMGEKE 60 WYFFSLRDRK YPTGIRTNRA TEAGYWKTTG KDKEIYRAGI LVGMKKTLVF YKGRAPKGEK 120 SNWVMHEYRL ETKLSFKPKK EEWVVCRVFK KSSAVKKPHQ PAPSSLPSLE SPCDTNTIVS 180 EFGDIEFPNM NSIANSSSGF SNINSAQSYN TSTDDNLNMN MNMNMNMNWA AAREAASLPS 240 LPWSSSLLSP NLQMNSLLIK ALQLGSYRPR EATSTENYSF LPQGISNFGT DFISNFQASS 300 SKVLDSLHQQ QQQQQQEQPF NLDSINW*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-58	4	157	16	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-58	4	157	16	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-58	4	157	16	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-58	4	157	16	171	NO APICAL MERISTEM PROTEIN
4dul_A	1e-58	4	157	16	171	NAC domain-containing protein 19
4dul_B	1e-58	4	157	16	171	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.17754	0.0	cell culture

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Accumulates during leaf and flower aging (PubMed:20113437). Induced by EIN2 during leaf aging, but negatively regulated by miR164, which expression decreases gradually with aging through negative regulation by EIN2 (PubMed:19229035). In leaves, accumulates at the tips and margins and in leaves undergoing senescence. Present in floral organs of partly or fully opened flowers, but not in young flower buds. Expressed in pollen grains of mature anthers, but not in immature anthers. In petals of open flowers mostly observed in the tip region. In mature siliques, accumulates at the abscission zone, in the distal portion of the valve margins and the tip. In roots, detected in primary and lateral roots, but not in root tips. In seeds present in embryos and the micropylar endosperm (PubMed:20113437, PubMed:23340744). {ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:23340744}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots and flowers, and, to a lower extent, in shoots and leaves. Particularly expressed in old and senescing tissues. {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:23340744}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00364	DAP	Transfer from AT3G18400	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM487670	0.0	AM487670.2 Vitis vinifera contig VV78X194222.8, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010663599.1	0.0	PREDICTED: NAC domain-containing protein 92
Swissprot	Q9FKA0	4e-83	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	A0A438JZB8	0.0	A0A438JZB8_VITVI; NAC domain-containing protein 92
TrEMBL	D7SIZ4	0.0	D7SIZ4_VITVI; Uncharacterized protein
STRING	VIT_17s0000g03660.t01	0.0	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G18400.1	1e-108	NAC domain containing protein 58

Link Out ? help Back to Top
Phytozome	GSVIVT01008291001

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]