PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01008241001 | ||||||||
Common Name | LOC100245771, VIT_17s0000g04130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 253aa MW: 27515.1 Da PI: 6.9718 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.2 | 2.5e-10 | 7 | 52 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwq 45 W+ eE++ + +a++++ ++ W++Ia++++ g++ ++k ++q GSVIVT01008241001 7 VWSREEEKAFENAIAMHWTEdckeVWDKIASMVP-GKSVDELKQHYQ 52 6*********************************.***********9 PP | |||||||
2 | Myb_DNA-binding | 39.3 | 1.5e-12 | 87 | 131 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + Rt+ q+ s+ qky GSVIVT01008241001 87 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 131 7*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 10.154 | 3 | 59 | IPR017884 | SANT domain |
SMART | SM00717 | 1.1E-4 | 4 | 57 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.11E-10 | 6 | 61 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.0E-8 | 7 | 53 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-4 | 7 | 54 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.40E-8 | 8 | 52 | No hit | No description |
PROSITE profile | PS51294 | 16.873 | 80 | 136 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.38E-17 | 82 | 137 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-10 | 84 | 134 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.1E-17 | 84 | 134 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 4.9E-11 | 85 | 130 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.6E-11 | 87 | 131 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.68E-10 | 87 | 132 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 253 aa Download sequence Send to blast |
MSSEVPVWSR EEEKAFENAI AMHWTEDCKE VWDKIASMVP GKSVDELKQH YQFLVEDVNA 60 IEAGHIPLPN YAADEASSEQ ERRKGIPWTE EEHRLFLLGL DKFGKGDWRS ISRNFVISRT 120 PTQVASHAQK YFIRLNSMNR DRRRSSIHDI TSVNNGDVST PQAPITGQQG NGNPASAAAA 180 GVGPPLKHHR AQPSMPAGAL GMYGTPMGHP VAAPPGHMAS AVGTPVMLPP GPHAPPYVVP 240 VAYPMAPPPM HQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-13 | 8 | 71 | 11 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.10013 | 0.0 | inflorescence| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in aboveground tissues, with the highest level in leaves. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00191 | DAP | Transfer from AT1G49010 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ381309 | 0.0 | FQ381309.1 Vitis vinifera clone SS0ACG10YP16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002274167.1 | 1e-180 | PREDICTED: transcription factor DIVARICATA | ||||
Swissprot | B8A9B2 | 5e-86 | MYBS1_ORYSI; Transcription factor MYBS1 | ||||
Swissprot | Q8LH59 | 5e-86 | MYBS1_ORYSJ; Transcription factor MYBS1 | ||||
TrEMBL | F6GTI5 | 1e-178 | F6GTI5_VITVI; Uncharacterized protein | ||||
STRING | VIT_17s0000g04130.t01 | 1e-179 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49010.1 | 4e-73 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01008241001 |
Entrez Gene | 100245771 |
Publications ? help Back to Top | |||
---|---|---|---|
|